spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY558544; SV 1; linear; genomic DNA; STD; FUN; 444 BP.
XX
AC   AY558544;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111192.01X YGL230C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-444
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-444
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-444
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838B11111D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..444
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111192.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>444
FT                   /product="YGL230C"
FT   CDS             1..444
FT                   /codon_start=1
FT                   /product="YGL230C"
FT                   /db_xref="GOA:P53074"
FT                   /db_xref="SGD:S000003199"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53074"
FT                   /protein_id="AAS56870.1"
FT                   /translation="MGIITLSGNVLHLLKAYPKKGLEEVSQPEPNTANDSSTEYKGKSK
FT                   DDFQMVEKSNTDERYNFTRTKKWFLLMTSEYYKLMENRLLMFCIIACSFICAIQFLFFI
FT                   IYWTNIVPRKTQRAITNLNYDYLTAHLKEQCVPYAKILDQCIL"
XX
SQ   Sequence 444 BP; 159 A; 80 C; 71 G; 134 T; 0 other;
     atgggaatta ttacactatc cggcaatgtt ctacatttat tgaaagccta cccaaaaaag        60
     ggccttgaag aggtttctca accagagcct aatacagcaa atgattcctc gactgaatat       120
     aaaggaaaaa gcaaggatga ttttcaaatg gtcgaaaaat ccaatacaga tgagagatac       180
     aattttacaa gaacgaaaaa atggttttta ttgatgacct cagaatatta caaactaatg       240
     gaaaacagac ttttaatgtt ttgcattatc gcttgctctt ttatttgtgc tatccaattt       300
     cttttcttta taatttattg gaccaacatt gttccacgga agacgcaaag ggcaataact       360
     aacctaaatt acgattattt aacagcccat ctaaaagagc aatgcgttcc atatgcgaaa       420
     attcttgacc aatgtattct ctag                                              444
//
spacer
spacer