spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY558469; SV 1; linear; genomic DNA; STD; FUN; 483 BP.
XX
AC   AY558469;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111585.01X YFL051C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-483
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-483
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-483
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838G12109D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..483
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111585.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>483
FT                   /product="YFL051C"
FT   CDS             1..483
FT                   /codon_start=1
FT                   /product="YFL051C"
FT                   /db_xref="GOA:P43552"
FT                   /db_xref="SGD:S000001843"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43552"
FT                   /protein_id="AAS56795.1"
FT                   /translation="MSIPHSVFSALLVFVALATTTLASTEACLPTNKREDGMNINFYEY
FT                   TIGDQTTYLEPEYMGYEYSNTKKLGSVSGQTNLSIYYSPPCESTPTCVTYAVLKRDEDG
FT                   YDPCGPLYETKKRDTEYCDPNTAYWSSDLFGFYTTPTNVTVEMTGYLIWSMGNRRR"
XX
SQ   Sequence 483 BP; 142 A; 103 C; 100 G; 138 T; 0 other;
     atgtctatac cccattccgt attttcggca ctcttggtct tcgtggcgct agctactaca        60
     accttagcca gtacagaagc ttgcttacca acaaacaaaa gggaagatgg tatgaatatt       120
     aatttttatg agtacacaat aggcgaccaa accacatact tggagcctga atatatgggc       180
     tatgaatact ccaatacaaa gaagttaggt tccgttagcg gacagaccaa tctctccata       240
     tactatagtc cgccttgtga gagcactcct acctgtgtga cttatgcagt tttgaagcgt       300
     gatgaggatg gatatgatcc ttgcggacct ctttatgaaa ctaaaaaacg tgacactgaa       360
     tactgtgacc caaatactgc ctattggagt tctgatcttt ttggtttcta tactactcca       420
     actaatgtaa ctgtggaaat gacagggtac ttaatatgga gtatgggcaa ccgacgccgt       480
     tga                                                                     483
//
spacer
spacer