spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY558447; SV 1; linear; genomic DNA; STD; FUN; 339 BP.
XX
AC   AY558447;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111536.01X YEL074W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-339
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-339
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-339
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838H08109D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..339
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111536.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>339
FT                   /product="YEL074W"
FT   CDS             1..339
FT                   /codon_start=1
FT                   /product="YEL074W"
FT                   /db_xref="InterPro:IPR007414"
FT                   /db_xref="SGD:S000000800"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39973"
FT                   /protein_id="AAS56773.1"
FT                   /translation="MDLRSALEKTNIIKSYKLHFLIRYTTSRFEVKEPFLAYLHMARQK
FT                   DKLLPKCITPPNKKADPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPSKSPKHKN
FT                   ILPFNFTK"
XX
SQ   Sequence 339 BP; 122 A; 95 C; 40 G; 82 T; 0 other;
     atggacctac gttccgctct cgaaaagacc aatataataa aaagttataa attacatttc        60
     cttattaggt atacgacctc gcgcttcgaa gtaaaggagc cctttttggc gtacctacat       120
     atggcgcgtc agaaagacaa acttctccca aaatgtatta ccccgccgaa taagaaagca       180
     gacccattca ccaacgacgt atcaagttac ttcacccaca cccacaccca cacaccatgc       240
     tcaccttcac ttgtatacac ttatgtcaat actacagaaa aatcaccatc aaaatcacct       300
     aaacataaaa atattctacc tttcaacttc acgaaataa                              339
//
spacer
spacer