spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY558386; SV 1; linear; genomic DNA; STD; FUN; 453 BP.
XX
AC   AY558386;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111410.01X YHL042W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-453
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-453
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-453
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838C11108D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..453
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111410.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>453
FT                   /product="YHL042W"
FT   CDS             1..453
FT                   /codon_start=1
FT                   /product="YHL042W"
FT                   /db_xref="GOA:P38729"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="SGD:S000001034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38729"
FT                   /protein_id="AAS56712.1"
FT                   /translation="MKQRFSQVATVIFFVMSIRSPRNLGFFFTLALFVVLVCSQEWFSF
FT                   EMNRSCSMKVEHRMQFLSTIISEHQKSDVNCWDQIAKKMNVYLFEQKVSGSDVFFLDGA
FT                   DCERFFERNFLRYLPSRKSSHPDLPIAELLPYIRKADIACAGKQLI"
XX
SQ   Sequence 453 BP; 123 A; 88 C; 88 G; 154 T; 0 other;
     atgaaacagc gtttttctca agtagcaact gttatattct tcgtcatgag tatccgttct        60
     ccaagaaatc tcggcttttt ttttactctt gccctttttg tcgtacttgt ttgctcccag       120
     gaatggttct cctttgaaat gaatagatct tgttcaatga aagtggaaca tagaatgcaa       180
     tttttgtcaa ctataatcag tgaacatcag aaatcggatg tgaattgttg ggaccaaatc       240
     gcaaagaaga tgaatgtata cttatttgag cagaaagttt ccggctcaga cgtgtttttc       300
     ttagatggag cagattgtga gcgctttttc gaacgtaatt tcctccgtta tctaccctca       360
     agaaagtctt cccatcctga cctaccaatt gctgaattgt tgccgtatat cagaaaagcc       420
     gacattgcct gtgctggtaa gcaattgatt taa                                    453
//
spacer
spacer