spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY558360; SV 1; linear; genomic DNA; STD; FUN; 339 BP.
XX
AC   AY558360;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111366.01X YKL177W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-339
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-339
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-339
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838A08108D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..339
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111366.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>339
FT                   /product="YKL177W"
FT   CDS             1..339
FT                   /codon_start=1
FT                   /product="YKL177W"
FT                   /db_xref="SGD:S000001660"
FT                   /db_xref="UniProtKB/Swiss-Prot:P34238"
FT                   /protein_id="AAS56686.1"
FT                   /translation="MMLVTAHDMPIFAPTCNLMTISHQPLPSHLVRKSSSLHIAASTIH
FT                   VKFIVRSHVIKMIAGIFLVCECHAKGGANSITASKQSPIIADLYDMKILIVFCLSYTNL
FT                   IASKVKKQ"
XX
SQ   Sequence 339 BP; 112 A; 71 C; 56 G; 100 T; 0 other;
     atgatgttgg taacggcaca tgatatgcca atattcgcac caacctgcaa cttgatgaca        60
     atatcacacc aacctttacc atcccatctc gtgaggaaat cgtcgtcact ccatattgcc       120
     gcatctacaa tacacgttaa attcattgta agaagccatg ttatcaaaat gattgctgga       180
     atattcttgg tatgtgaatg ccatgctaaa gggggagcta atagtatcac agctagcaaa       240
     caaagcccta ttattgctga cttgtatgac atgaaaattt tgatagtatt ttgcctttcc       300
     tacacaaatt taattgcctc taaagttaaa aagcaataa                              339
//
spacer
spacer