spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY558359; SV 1; linear; genomic DNA; STD; FUN; 618 BP.
XX
AC   AY558359;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111365.01X YKL147C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-618
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-618
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-618
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838H07108D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..618
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111365.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>618
FT                   /product="YKL147C"
FT   CDS             1..618
FT                   /codon_start=1
FT                   /product="YKL147C"
FT                   /db_xref="SGD:S000001630"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36061"
FT                   /protein_id="AAS56685.1"
FT                   /translation="MSPPCNCRLLLGFLIKWRATASTTCGSGLFMLTSSVPLLQEVCDA
FT                   SGTLACTASLFTSSGGFFSKPPVVPLDFLLLLLLLLLPLLLPPLPSVKGEPDACEIPVL
FT                   PPLLFFLLLLLCVLPEPLETSFPFISAMQSLIRFLINFASHSFTTDHRSFLFHSLTSTN
FT                   DNTRKRPDRVTNPFTISRSTFSNNVVYIRIYSYSSPKYTFPC"
XX
SQ   Sequence 618 BP; 136 A; 166 C; 113 G; 203 T; 0 other;
     atgtctccgc cttgcaattg taggctgtta ctcgggtttc ttatcaagtg gcgtgccacg        60
     gcatctacca catgtggctc agggttattt atgctcactt caagcgtgcc attgttacag       120
     gaagtgtgcg acgcgtcggg tacgctagca tgcaccgctt cattgttcac aagcagcggc       180
     ggctttttta gcaaaccacc tgtagttcca ctagattttc tacttctgct tctacttcta       240
     ctattaccgt tgctattgcc accgttgccg tccgttaaag gtgagccaga cgcatgcgag       300
     attcctgtac tgcctccgtt gttatttttt ttgttgttgt tgctctgcgt tcttccagag       360
     ccacttgaaa cctcttttcc attcatatcc gcgatgcaat cccttatacg cttcttaata       420
     aactttgctt cccactcttt cactactgac catcgatcct tcttatttca tagcctcacg       480
     agcacaaatg ataatacgag aaaaaggccc gaccgggtaa ccaacccttt tactatctct       540
     cgctctacct ttagtaataa tgtcgtctat ataaggattt actcatacag tagtccaaaa       600
     tatacctttc cgtgctaa                                                     618
//
spacer
spacer