spacer
spacer

EBI Dbfetch

ID   AY558358; SV 1; linear; genomic DNA; STD; FUN; 510 BP.
XX
AC   AY558358;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111364.01X YKL153W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-510
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-510
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-510
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838G07108D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..510
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111364.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>510
FT                   /product="YKL153W"
FT   CDS             1..510
FT                   /codon_start=1
FT                   /product="YKL153W"
FT                   /db_xref="SGD:S000001636"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36058"
FT                   /protein_id="AAS56684.1"
FT                   /translation="MEGKRNHQIIHSSDLFLTLVGNSSGTSSGSFWVQVVRWLRWLQVF
FT                   VQFEDQWNTSWDVQLSNVSIRDTFQVLNQTSQGVTVSGDHDGLTTQQVLGNDILPVWQQ
FT                   SVNDQSQRFSFWQDIWVNVLVSFITLLREWRRSVDWGRWNIEGSSVGVEFFFTELLQSF
FT                   SLVLTL"
XX
SQ   Sequence 510 BP; 143 A; 112 C; 114 G; 141 T; 0 other;
     atggagggaa aaagaaatca tcaaatcatt cattcttcag acttatttct taccttggtt        60
     ggcaacagca gcggcaccag cagcggcagc ttctgggtcc aagtagtaag atggcttaga       120
     tggcttcaag ttttcgtcca attcgaagac caatggaata ccagttggga tgttcaactt       180
     agcaatgtca gcatcagaga taccttccaa gtgcttaacc aaacctctca aggagttacc       240
     gtgagcggcg atcatgacgg tcttaccact caacaagtcc ttggcaatga catcttgcca       300
     gtatggcaac aatctgtcaa tgaccaaagc caaagattca gtttctggca agacatttgg       360
     gtcaacgtac ttgtatcttt catcaccctt ttgagagaat ggagaagaag cgtcgattgg       420
     gggaggtgga acatcgaagg atcttctgta ggtgttgaat ttttcttcac cgaacttctt       480
     caaagtttca gccttgtcct taccttgtaa                                        510
//


  
spacer
spacer