![]() |
EBI DbfetchID AY558358; SV 1; linear; genomic DNA; STD; FUN; 510 BP. XX AC AY558358; XX DT 16-MAR-2004 (Rel. 79, Created) DT 01-MAY-2007 (Rel. 91, Last updated, Version 2) XX DE Saccharomyces cerevisiae clone FLH111364.01X YKL153W gene, complete cds. XX KW Yeast ORF Project. XX OS Saccharomyces cerevisiae (baker's yeast) OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; OC Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX RN [1] RP 1-510 RX DOI; 10.1101/gr.6037607 RX PUBMED; 17322287. RA Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F., RA Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J., RA Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J., RA Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.; RT "Approaching a complete repository of sequence-verified protein-encoding RT clones for Saccharomyces cerevisiae"; RL Genome Res. 17(4):536-543(2007). XX RN [2] RP 1-510 RA Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E., RA Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D., RA Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L., RA Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.; RT "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae RT ORFs in the Gateway recombinational cloning system"; RL Unpublished. XX RN [3] RP 1-510 RA Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E., RA Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D., RA Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L., RA Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.; RT ; RL Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases. RL Biological Chemistry and Molecular Pharmacology, Harvard Institute of RL Proteomics, 320 Charles St., Cambridge, MA 02141, USA XX DR ImaGenes; RZPDo838G07108D. XX CC This clone is part of a collection of Saccharomyces cerevisiae CC full-length ORF clones generated by the Harvard Institute of CC Proteomics. Each CDS has been cloned with its native stop-codon. CC The CDS has been directionally cloned using the Gateway cloning CC system into the donor vectors pDONR 201 or pDONR 221. Additional CC sequences in the clone: 'TCCAGCTGACCACC' after the attL1 site and CC before the 'ATG' (from Research Genetics primers used to amplify CC the ORFs, including a Kozak consensus sequence); CC 'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2 CC site (from the Research Genetics primers used to amplify the ORFs). XX FH Key Location/Qualifiers FH FT source 1..510 FT /organism="Saccharomyces cerevisiae" FT /lab_host="Escherichia coli DH5alpha T1 resistant" FT /mol_type="genomic DNA" FT /clone="FLH111364.01X" FT /db_xref="taxon:4932" FT mRNA <1..>510 FT /product="YKL153W" FT CDS 1..510 FT /codon_start=1 FT /product="YKL153W" FT /db_xref="SGD:S000001636" FT /db_xref="UniProtKB/Swiss-Prot:P36058" FT /protein_id="AAS56684.1" FT /translation="MEGKRNHQIIHSSDLFLTLVGNSSGTSSGSFWVQVVRWLRWLQVF FT VQFEDQWNTSWDVQLSNVSIRDTFQVLNQTSQGVTVSGDHDGLTTQQVLGNDILPVWQQ FT SVNDQSQRFSFWQDIWVNVLVSFITLLREWRRSVDWGRWNIEGSSVGVEFFFTELLQSF FT SLVLTL" XX SQ Sequence 510 BP; 143 A; 112 C; 114 G; 141 T; 0 other; atggagggaa aaagaaatca tcaaatcatt cattcttcag acttatttct taccttggtt 60 ggcaacagca gcggcaccag cagcggcagc ttctgggtcc aagtagtaag atggcttaga 120 tggcttcaag ttttcgtcca attcgaagac caatggaata ccagttggga tgttcaactt 180 agcaatgtca gcatcagaga taccttccaa gtgcttaacc aaacctctca aggagttacc 240 gtgagcggcg atcatgacgg tcttaccact caacaagtcc ttggcaatga catcttgcca 300 gtatggcaac aatctgtcaa tgaccaaagc caaagattca gtttctggca agacatttgg 360 gtcaacgtac ttgtatcttt catcaccctt ttgagagaat ggagaagaag cgtcgattgg 420 gggaggtgga acatcgaagg atcttctgta ggtgttgaat ttttcttcac cgaacttctt 480 caaagtttca gccttgtcct taccttgtaa 510 // ![]() |