spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY558268; SV 1; linear; genomic DNA; STD; FUN; 315 BP.
XX
AC   AY558268;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH111194.01X YGL239C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-315
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-315
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-315
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838B09107D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..315
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH111194.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>315
FT                   /product="YGL239C"
FT   CDS             1..315
FT                   /codon_start=1
FT                   /product="YGL239C"
FT                   /db_xref="GOA:P53069"
FT                   /db_xref="SGD:S000003208"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53069"
FT                   /protein_id="AAS56594.1"
FT                   /translation="MKFLKNKAPANLVDNGRFVEAITCNKVKPNPSCVSNCLKFLSEVL
FT                   AVEAITDSARNLATVSKSDILLFSLLQLSSNKQSGSSLPLFDLVFILLSTFFLFHNPCN
FT                   "
XX
SQ   Sequence 315 BP; 90 A; 66 C; 54 G; 105 T; 0 other;
     atgaaatttt tgaagaacaa agcacctgct aatctggtgg ataacggcag gtttgtggaa        60
     gcaataacgt gcaataaagt taaaccgaat ccatcttgcg tctccaactg cctcaaattt       120
     ctttccgaag ttttagcggt agaagcaata actgattcgg ccagaaattt agctacggtt       180
     tccaaatcgg acatcctact attttctctt ctacaattga gtagcaataa acagagcggg       240
     tcctctttgc cactttttga tcttgtgttt atactacttt caactttttt tttattccat       300
     aatccctgca attga                                                        315
//
spacer
spacer