EBI Dbfetch

ID   AY558053; SV 1; linear; genomic DNA; STD; FUN; 393 BP.
XX
AC   AY558053;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH007105.01X YPR200C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-393
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-393
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-393
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838E04103D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..393
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH007105.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>393
FT                   /product="YPR200C"
FT   CDS             1..393
FT                   /codon_start=1
FT                   /product="YPR200C"
FT                   /note="ARR2"
FT                   /db_xref="GOA:Q06597"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="SGD:S000006404"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06597"
FT                   /protein_id="AAS56379.1"
FT                   /translation="MVSFITSRQLKGLIENQRKDFQVVDLRREDFARDHITNAWHVPVT
FT                   AQITEKQLNQLIKGLSDTFSSSQFVKVIFHCTGSKNRGPKVAAKFETYLQEEDITSKFE
FT                   SCILVGGFYAWETHCRESNLKLIVSG"
XX
SQ   Sequence 393 BP; 129 A; 62 C; 86 G; 116 T; 0 other;
     atggtaagtt tcataacgtc taggcaactc aagggcctaa ttgaaaatca gaggaaggat        60
     tttcaagttg ttgatcttcg aagagaagat tttgcacgtg atcatattac aaacgcttgg       120
     catgttccag taacagcaca gattacagag aagcaactga atcaattaat taaaggttta       180
     tccgatactt tctcaagttc tcaattcgtc aaagtgatat ttcattgtac tgggtccaag       240
     aataggggac caaaagtagc tgctaaattc gaaacctact tacaagaaga agatattaca       300
     agtaagtttg agagttgcat cctcgttgga ggtttttacg cttgggagac ccattgtaga       360
     gagagtaacc ttaaattgat tgttagtggt tga                                    393
//