EBI Dbfetch

ID   AY557895; SV 1; linear; genomic DNA; STD; FUN; 504 BP.
XX
AC   AY557895;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH004141.01X YKL026C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-504
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-504
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-504
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838D02103D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..504
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH004141.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>504
FT                   /product="YKL026C"
FT   CDS             1..504
FT                   /codon_start=1
FT                   /product="YKL026C"
FT                   /note="GPX1"
FT                   /db_xref="GOA:P36014"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="SGD:S000001509"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36014"
FT                   /protein_id="AAS56221.1"
FT                   /translation="MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKEL
FT                   EYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQD
FT                   PVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPP
FT                   EEQI"
XX
SQ   Sequence 504 BP; 176 A; 88 C; 101 G; 139 T; 0 other;
     atgcaagaat tttattcttt ttcaccaata gatgaaaacg gaaatccatt ccccttcaac        60
     tccctgcgta acaaagtggt tttgatagtc aatgtagcat ctcattgtgc gttcacacct       120
     caatacaagg aattagagta cttgtacgaa aaatacaaat cacatggtct agtgattgtg       180
     gcctttccct gtggtcaatt cggaaatcaa gagttcgaga aggataaaga gattaataag       240
     ttctgtcaag ataaatatgg tgtaaccttc cctattctac ataagatccg ttgcaacggg       300
     caaaagcaag atcccgtcta caagttctta aagaattcag taagcgggaa gtctggaata       360
     aaaatgataa aatggaattt tgaaaagttt gtggtagacc gaaatgggaa ggtggttaaa       420
     aggttttcat gcatgactag gccactagag ctttgtccaa taatcgaaga attactgaat       480
     caaccaccag aagaacagat ttaa                                              504
//