spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY557866; SV 1; linear; genomic DNA; STD; FUN; 1005 BP.
XX
AC   AY557866;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH000787.01X YBR046C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-1005
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-1005
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-1005
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838E09103D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1005
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH000787.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>1005
FT                   /product="YBR046C"
FT   CDS             1..1005
FT                   /codon_start=1
FT                   /product="YBR046C"
FT                   /note="ZTA1"
FT                   /db_xref="GOA:P38230"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="SGD:S000000250"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38230"
FT                   /protein_id="AAS56192.1"
FT                   /translation="MKCTIPEQQKVILIDEIGGYDVIKYEDYPVPSISEEELLIKNKYT
FT                   GVNYIESYFRKGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQVAYISNSTFAQYSK
FT                   ISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGL
FT                   ILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTNGKGVDASF
FT                   DSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPE
FT                   EWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVLEIPQ"
XX
SQ   Sequence 1005 BP; 327 A; 174 C; 218 G; 286 T; 0 other;
     atgaaatgta ctataccaga acagcaaaaa gtcattttga ttgatgaaat tggtggatac        60
     gatgtaatca agtatgagga ttatcctgta ccatcgattt cggaggaaga gttactaatc       120
     aaaaataagt acacgggtgt taattacatc gaaagttact ttcggaaggg tatttatccc       180
     tgtgaaaaac catacgtatt gggcagggaa gcgtcgggga ccgttgtagc aaaaggtaaa       240
     ggggtaacta attttgaagt tggagaccaa gttgcttata tatctaactc aacttttgca       300
     cagtattcaa aaatttcgtc ccaaggccca gtcatgaagc tgccaaaggg aacgagtgac       360
     gaagagttga aactttatgc ggctggttta ttacaagttc tcactgcttt atcatttaca       420
     aacgaagcgt atcacgtcaa aaagggcgac tatgtattac tttttgccgc agcgggtggt       480
     gtgggattga ttttaaatca gctactcaag atgaaaggtg cacatacgat tgcagttgcc       540
     tcaactgatg aaaagcttaa aatagcgaag gaatacggcg ccgaatactt gatcaacgct       600
     tcgaaagagg atattttaag acaagtttta aaattcacta atggtaaggg cgttgatgct       660
     agttttgact cggtcggaaa ggataccttt gaaatcagct tagccgcact aaaaagaaaa       720
     ggtgtattcg tttcctttgg taatgcatct ggtcttatcc cgccattctc tattaccaga       780
     ctttccccaa aaaatattac tttggtgaga cctcaacttt acggctatat cgccgatcct       840
     gaagaatgga aatattactc tgacgagttt tttggtctgg ttaattcaaa gaagttgaac       900
     atcaaaatat acaaaactta tccattacgg gattatagaa ctgcagctgc tgacatagaa       960
     agtagaaaaa ctgttggtaa gctagttctt gaaataccac aatag                      1005
//
spacer
spacer