spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY557802; SV 1; linear; genomic DNA; STD; FUN; 462 BP.
XX
AC   AY557802;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH002463.01X YEL028W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-462
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-462
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-462
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDo838B05104D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..462
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH002463.01X"
FT                   /note="sequence discrepancy relative to SGD (YEL028W):
FT                   a27t"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>462
FT                   /product="YEL028W"
FT   CDS             1..462
FT                   /codon_start=1
FT                   /product="YEL028W"
FT                   /db_xref="SGD:S000000754"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39989"
FT                   /protein_id="AAS56128.1"
FT                   /translation="MKITITSLLFFLVMIVELASAGTLLHNGANLPSLRDNTTLTDARN
FT                   VLKYLQVLGFPSNKIAATDTVGTFIIFSNRTEANTTAMTKTVSYCYRNYGHSFYFTHYK
FT                   YDYFPSGISYMAKLGDATVNHTDLPHFRNNKRLTTQELNAFQHPIVEFQ"
XX
SQ   Sequence 462 BP; 143 A; 107 C; 80 G; 132 T; 0 other;
     atgaaaataa caataacaag ccttcttttt tttcttgtca tgatcgtcga gctcgcaagt        60
     gcgggcacac tacttcataa tggtgcaaat ttgccctcat tacgtgataa caccactcta       120
     actgatgctc gtaatgtgtt aaagtactta caagtgcttg gttttccaag caacaaaata       180
     gcggctacag atactgttgg aacttttatc atatttagca atcgtacgga agctaacact       240
     accgctatga cgaagacagt gtcatactgt tatcgtaact acgggcatag tttctacttc       300
     actcattaca aatacgacta ttttcctagc gggattagtt atatggcaaa acttggcgat       360
     gccaccgtca accatacgga cttacctcac tttaggaaca acaaacggct aacaacgcaa       420
     gaactcaatg ccttccaaca tccaattgtc gagtttcagt aa                          462
//
spacer
spacer