![]() |
EBI DbfetchID AY365138; SV 1; linear; mRNA; STD; FUN; 549 BP. XX AC AY365138; XX DT 10-SEP-2003 (Rel. 77, Created) DT 09-DEC-2003 (Rel. 78, Last updated, Version 2) XX DE Aspergillus niger putative KTR1 mRNA, partial cds. XX KW . XX OS Aspergillus niger OC Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; OC Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; OC Aspergillus. XX RN [1] RP 1-549 RX DOI; 10.1128/AEM.69.12.6979-6986.2003 RX PUBMED; 14660339. RA Valkonen M., Ward M., Wang H., Penttila M., Saloheimo M.; RT "Improvement of foreign-protein production in Aspergillus niger var. RT awamori by constitutive induction of the unfolded-protein response"; RL Appl. Environ. Microbiol. 69(12):6979-6986(2003). XX RN [2] RP 1-549 RA Valkonen M., Ward M., Wang H., Penttila M., Saloheimo M.; RT ; RL Submitted (11-AUG-2003) to the EMBL/GenBank/DDBJ databases. RL Biotechnology, VTT, Tietotie 2, Espoo 02044-VTT, Finland XX FH Key Location/Qualifiers FH FT source 1..549 FT /organism="Aspergillus niger" FT /mol_type="mRNA" FT /db_xref="taxon:5061" FT CDS <1..298 FT /codon_start=2 FT /product="putative KTR1" FT /note="ktr1" FT /db_xref="GOA:Q6UNZ9" FT /db_xref="InterPro:IPR002685" FT /db_xref="UniProtKB/TrEMBL:Q6UNZ9" FT /protein_id="AAQ72811.1" FT /translation="HASALDHAGGFFYERWGDAPVHSIAAGLLLKKEQIHFFNEIGYYH FT VPFTHCPTGEQLRLDLKCHCNPKDNFDWKGYSCTSRFFQVNDMDKPKGYENES" XX SQ Sequence 549 BP; 154 A; 145 C; 125 G; 125 T; 0 other; ccacgcgtcc gcgctcgacc acgctggtgg cttcttctat gaacgttggg gcgatgcacc 60 agtccactct atcgctgcgg gacttctctt gaagaaggag cagatccatt tcttcaacga 120 gattggctac taccacgtcc cctttaccca ctgcccgact ggtgagcagc ttaggctgga 180 cctgaagtgc cactgcaacc ctaaagacaa ctttgactgg aagggatact cttgcacgtc 240 ccggttcttc caagtcaacg acatggacaa gcccaagggc tacgagaatg agagctgagt 300 gcttcactct taatataatt taaaaaaaaa aattaattgg aaatattgtc tttgcgcagc 360 gcgaaattgg ccgtgcatgt gatcagcaaa gccggacatc tcttgaccac gcaccgtcga 420 gtggcactgt ccaggcgtaa gaaaacgtcc actaacggga taattcccag ctcgttacta 480 aacccttctc atgatgatcc tgcaggatgc tggacgcagg ttcacaacat ttgaaaaaaa 540 aaaaaaaaa 549 // ![]() |