![]() |
EBI DbfetchID AY254574; SV 1; linear; genomic DNA; STD; FUN; 480 BP. XX AC AY254574; XX DT 08-JUL-2003 (Rel. 76, Created) DT 15-JAN-2005 (Rel. 82, Last updated, Version 2) XX DE Auricularia auricula-judae b-glucan synthase (fks) gene, partial cds. XX KW . XX OS Auricularia auricula-judae (ear fungus) OC Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; OC Auriculariales; Auriculariaceae; Auricularia. XX RN [1] RP 1-480 RX DOI; 10.1007/s00253-004-1662-y RX PUBMED; 15558276. RA Reverberi M., Di Mario F., Tomati U.; RT "beta-Glucan synthase induction in mushrooms grown on olive mill RT wastewaters"; RL Appl. Microbiol. Biotechnol. 66(2):217-225(2004). XX RN [2] RP 1-480 RA Reverberi M., Di Mario F.; RT ; RL Submitted (12-MAR-2003) to the EMBL/GenBank/DDBJ databases. RL IBAF, CNR, via Salaria Km 29.300, Monterotondo Scalo, RM 00016, Italy XX FH Key Location/Qualifiers FH FT source 1..480 FT /organism="Auricularia auricula-judae" FT /mol_type="genomic DNA" FT /db_xref="taxon:29892" FT gene <1..>480 FT /gene="fks" FT CDS <1..>480 FT /codon_start=1 FT /gene="fks" FT /product="b-glucan synthase" FT /EC_number="2.4.1.34" FT /note="FKS" FT /db_xref="GOA:Q7Z947" FT /db_xref="InterPro:IPR003440" FT /db_xref="UniProtKB/TrEMBL:Q7Z947" FT /protein_id="AAP81866.1" FT /translation="LEECLKIRSVLAEFEEMKADEVSPYTPGIKSEAKYPVAILGAREY FT IFSENIGILGDIAAGKEQTFGTMFARTMSQIGGKLHYGHPDFLNGIFMTTRGGVSKAQK FT GLHLNEDIYAGMNALLRGGRIKHCEYYQCGKGRDLGFGSILNFTTKIGLVWANICL" XX SQ Sequence 480 BP; 117 A; 110 C; 120 G; 133 T; 0 other; ctcgaggagt gtctcaagat tcgcagtgtt cttgctgaat tcgaggaaat gaaggccgac 60 gaggtctctc cttatacgcc cggaatcaag agtgaagcca agtaccctgt cgctattctt 120 ggagctcgcg agtacatttt ctcagagaac attggtatcc tcggtgatat tgctgccgga 180 aaagaacaga cattcggtac catgttcgct agaacaatgt cccaaattgg cggcaagctt 240 cattacggtc accctgattt cctcaacggt attttcatga caactcgtgg tggtgtttcc 300 aaagcccaga agggtctgca tctcaatgaa gatatttacg ccggtatgaa tgcactcctt 360 cgaggtggtc gtatcaagca ttgcgaatac taccagtgtg gcaagggtcg tgatctgggt 420 tttggctcca ttcttaactt cacgaccaag attggtctgg tatgggcgaa catatgtctt 480 // ![]() |