![]() |
EBI DbfetchID AY113284; SV 1; linear; mRNA; STD; INV; 655 BP. XX AC AY113284; XX DT 27-MAY-2002 (Rel. 71, Created) DT 27-MAY-2002 (Rel. 71, Last updated, Version 1) XX DE Drosophila melanogaster AT18611 full insert cDNA. XX KW FLI_CDNA. XX OS Drosophila melanogaster (fruit fly) OC Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; OC Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; OC Drosophilidae; Drosophila; Sophophora. XX RN [1] RP 1-655 RA Stapleton M., Brokstein P., Hong L., Agbayani A., Carlson J., Champe M., RA Chavez C., Dorsett V., Dresnek D., Farfan D., Frise E., George R., RA Gonzalez M., Guarin H., Kronmiller B., Li P., Liao G., Miranda A., RA Mungall C.J., Nunoo J., Pacleb J., Paragas V., Park S., Patel S., RA Phouanenavong S., Wan K., Yu C., Lewis S.E., Rubin G.M., Celniker S.; RT ; RL Submitted (16-MAY-2002) to the EMBL/GenBank/DDBJ databases. RL Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, RL One Cyclotron Road, Berkeley, CA 94720, USA XX CC Sequence submitted by: CC Berkeley Drosophila Genome Project CC Lawrence Berkeley National Laboratory CC Berkeley, CA 94720 CC This clone was sequenced as part of a high-throughput process to CC sequence clones from Drosophila Gene Collection 1 (Rubin et al., CC Science 2000). The sequence has been subjected to integrity checks CC for sequence accuracy, presence of a polyA tail and contiguity CC within 100 kb in the genome. Thus we believe the sequence to CC reflect accurately this particular cDNA clone. However, there are CC artifacts associated with the generation of cDNA clones that may CC have not been detected in our initial analyses such as internal CC priming, priming from contaminating genomic DNA, retained introns CC due to reverse transcription of unspliced precursor RNAs, and CC reverse transcriptase errors that result in single base changes. CC For further information about this sequence, including its location CC and relationship to other sequences, please visit our Web site CC (http://fruitfly.berkeley.edu) or send email to CC cdna@fruitfly.berkeley.edu. XX FH Key Location/Qualifiers FH FT source 1..655 FT /organism="Drosophila melanogaster" FT /mol_type="mRNA" FT /db_xref="taxon:7227" FT misc_feature 11..655 FT /note="sim4 alignment with AE003791 (57A3-57B3)" FT CDS 79..453 FT /codon_start=1 FT /product="AT18611p" FT /note="Longest ORF" FT /db_xref="FLYBASE:FBgn0050148" FT /db_xref="UniProtKB/TrEMBL:Q8MKJ9" FT /protein_id="AAM29289.1" FT /translation="MPTLPLCLLLLVLAIAFGHAYEAPEAQVRVFYPRGFEVSIPDAEG FT ISLFAFHGKLNEEFDGLEAGQWSRDIPKAKRGRWTFRDHKTKLNHGDTLYFWTYVIYNG FT LGYRQDEGAHVVTSYDNPHK" XX SQ Sequence 655 BP; 172 A; 155 C; 156 G; 172 T; 0 other; gtttgaaggc aggtccgctc atcgagttta gttctgttcg gaggtccgat accgcaacac 60 gttccatttc gattcgtgat gcctacactt ccgctgtgcc tgctgctcct ggtgttggcg 120 attgcctttg gccacgccta cgaggcacct gaggcacagg tgcgcgtgtt ctatccccgg 180 ggattcgagg tctccattcc ggatgcggag ggtatttcac tgtttgcctt ccatggcaag 240 ctaaacgagg agttcgacgg cctggaggcg ggacaatggt ccagggatat tccgaaagcc 300 aagcggggac gttggacatt ccgagatcac aagacaaagc tcaaccatgg agataccctg 360 tacttttgga cctacgtcat ttacaacggg ctgggctata gacaggatga aggtgctcat 420 gtggtcacca gttacgacaa tccacataaa tagtgtcatc tttcaattat gggatcgtgg 480 acgagcttaa agctcatctt gaacctttgt ttatggagcg tactttccat gctcatccgc 540 tcttttggct cacagctaat ctttttgctt gctacacaaa gaacaatgcg ttcacaaata 600 ataataataa ttcaccaaat taaagtgtta tcaaaacaaa aaaaaaaaaa aaaaa 655 // ![]() |