![]() |
EBI DbfetchID AY094665; SV 1; linear; mRNA; STD; INV; 1105 BP. XX AC AY094665; XX DT 16-APR-2002 (Rel. 71, Created) DT 16-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Drosophila melanogaster AT28119 full insert cDNA. XX KW FLI_CDNA. XX OS Drosophila melanogaster (fruit fly) OC Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; OC Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; OC Drosophilidae; Drosophila; Sophophora. XX RN [1] RP 1-1105 RA Stapleton M., Brokstein P., Hong L., Agbayani A., Carlson J., Champe M., RA Chavez C., Dorsett V., Dresnek D., Farfan D., Frise E., George R., RA Gonzalez M., Guarin H., Kronmiller B., Li P., Liao G., Miranda A., RA Mungall C.J., Nunoo J., Pacleb J., Paragas V., Park S., Patel S., RA Phouanenavong S., Wan K., Yu C., Lewis S.E., Rubin G.M., Celniker S.; RT ; RL Submitted (03-APR-2002) to the EMBL/GenBank/DDBJ databases. RL Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, RL One Cyclotron Road, Berkeley, CA 94720, USA XX CC Sequence submitted by: CC Berkeley Drosophila Genome Project CC Lawrence Berkeley National Laboratory CC Berkeley, CA 94720 CC This clone was sequenced as part of a high-throughput process to CC sequence clones from Drosophila Gene Collection 1 (Rubin et al., CC Science 2000). The sequence has been subjected to integrity checks CC for sequence accuracy, presence of a polyA tail and contiguity CC within 100 kb in the genome. Thus we believe the sequence to CC reflect accurately this particular cDNA clone. However, there are CC artifacts associated with the generation of cDNA clones that may CC have not been detected in our initial analyses such as internal CC priming, priming from contaminating genomic DNA, retained introns CC due to reverse transcription of unspliced precursor RNAs, and CC reverse transcriptase errors that result in single base changes. CC For further information about this sequence, including its location CC and relationship to other sequences, please visit our Web site CC (http://fruitfly.berkeley.edu) or send email to CC cdna@fruitfly.berkeley.edu. XX FH Key Location/Qualifiers FH FT source 1..1105 FT /organism="Drosophila melanogaster" FT /map="96B14-96B14" FT /mol_type="mRNA" FT /db_xref="taxon:7227" FT CDS 98..1066 FT /codon_start=1 FT /gene="CG11780" FT /product="AT28119p" FT /note="Longest ORF" FT /db_xref="FLYBASE:FBgn0039258" FT /db_xref="GOA:Q8T3P3" FT /db_xref="HSSP:1NMM" FT /db_xref="InterPro:IPR003859" FT /db_xref="UniProtKB/TrEMBL:Q8T3P3" FT /protein_id="AAM11018.1" FT /translation="MVNISTINWVFVCGLSFCLGGIAVLSLMPLGSDCVCPLSNPLAKL FT AGGGEGVSVIKKEPADEKQPQPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQ FT GVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSL FT GPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDGEFFVRIRDAG FT LQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKV FT HEMLIDQVPVTILNILLDCDVNKTPWCDCSGTAAAASAVQT" XX SQ Sequence 1105 BP; 286 A; 290 C; 287 G; 242 T; 0 other; gcacacttcc aaccggcagc taaaaagttt ataatatttt ccgcctatgg cccgacttcg 60 ttcaaaccac tggacttctg tataaaagcg gctccaaatg gtgaatatat ccaccataaa 120 ctgggtcttc gtctgcggcc tgtccttttg cctgggcggg attgcggtgc tcagtctcat 180 gccattggga tcagactgcg tgtgcccgct gtccaatccg ctggccaagc ttgccggtgg 240 cggagaagga gtatccgtga ttaagaaaga gccagccgat gagaagcagc cacagccaca 300 tgaccacggt gcgtccgtac acaagatggc actgctggtg ccgtttcgag accgatttga 360 ggaactcctc cagttcgtcc cccacatgac cgcctttttg aagcggcagg gcgtggcgca 420 ccacatcttt gtgctgaacc aggtggacag gttccgcttc aatcgcgcct ctctcatcaa 480 cgtgggtttc cagtttgcca gcgatgtgta cgattacatt gccatgcacg acgtagactt 540 gctgcccttg aatgacaatc tgctctatga gtatcccagc agcttgggac cactgcacat 600 cgccggaccg aagctacatc ccaaatacca ctatgataac ttcgttggag gaatattact 660 ggtgcgacgc gagcacttta agcagatgaa cggcatgtcg aaccagtact ggggctgggg 720 attagaggac ggcgagttct tcgtgcgcat ccgggatgca ggactgcagg tgacgcggcc 780 gcagaacatt aagactggca ctaatgatac attcagccat attcacaacc gctatcatcg 840 taagcgggac acccagaagt gcttcaacca gaaggagatg acccgcaagc gggaccacaa 900 gacgggcctg gacaacgtga agtacaaaat acttaaggtg catgagatgc tcattgacca 960 ggtgccggtg accatcctca acattttgct cgattgtgat gttaataaaa cgccttggtg 1020 cgactgctcc ggaacggcag cggctgcatc ggcggtacaa acctgatggg ttgtgttaaa 1080 ccaaaaaaaa aaaaaaaaaa aaaaa 1105 // ![]() |