EBI Dbfetch

ID   AY088660; SV 1; linear; mRNA; STD; PLN; 1568 BP.
XX
AC   AY088660;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 5)
XX
DE   Arabidopsis thaliana clone 8980 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
OC   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
XX
RN   [1]
RP   1-1568
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-1568
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-1568
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1568
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="8980"
FT                   /db_xref="taxon:3702"
FT   CDS             91..1440
FT                   /codon_start=1
FT                   /product="beta-1,3-glucanase-like protein"
FT                   /db_xref="GOA:Q8L935"
FT                   /db_xref="HSSP:1AQ0"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L935"
FT                   /protein_id="AAM66982.1"
FT                   /translation="MAKAPPSISLLLLLCAAVFLTIPAVISAIGVNYGTLGNLPPPTQV
FT                   ANFIKTQTSIDNVKIFDVNPDILRAFAGTGISVVVTVPNGDIPALANGRQARRWVSVNI
FT                   LPFHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNALVRAGVRDVKVTTAHSLNI
FT                   IAYDLTGAPSSGRFRPGWDKGILAPILAYHRRTKSPFMVNPYPYFGFDPKNVNFAIFRT
FT                   PYKAVRDPFTRHVYTNMFDALMDSTYSAMKALGYGDVNIVVGETGWPSACDAPWCSPAN
FT                   AAWFNLNIIKRAQGQGTPLMPNRRFETYIFGLFNEEGKPGPTAERNWGLFRADFSPVYD
FT                   VGLLRNGQGGGGRPALPAPSTAGGKWCVARSGATNTQLQDSINWVCGQGVDCKPIQAGG
FT                   SCFNPSSLRTHASFVMNAYFQSHGRTDGACNFSGTGMIVGNNPSNGACKY"
XX
SQ   Sequence 1568 BP; 384 A; 398 C; 362 G; 424 T; 0 other;
     ctattcgtcg taataataaa aacacaactc aaacgattca cgggtttcac ttggaatcgt        60
     ttggttttct catttccgaa atataaaaag atggccaaag cgccaccgtc aatctctctt       120
     ctcctcctcc tctgcgccgc cgtattcctc accatccccg ccgtgatctc cgccatcggt       180
     gttaactacg gaactctcgg aaacctccca ccaccgactc aggtggctaa ctttatcaag       240
     acacaaactt cgattgataa cgtcaagatc ttcgatgtga atcccgatat cctacgtgcc       300
     ttcgctggaa ctggtatctc cgtcgttgtc accgttccta acggtgatat tccggcgttg       360
     gctaacggaa gacaagctcg tcggtgggtt tcggttaaca ttttgccgtt tcatcctcag       420
     acgaagatta agtatatctc agtcggaaat gagattctgc tcaccggaga taataacatg       480
     atcaataatc tcttaccggc gatgaggaat cttaacaacg ctttggttcg tgctggtgtc       540
     agagatgtta aggttacaac cgcacactca cttaacatca tagcctatga cctgaccggt       600
     gcaccaagca gcggtagatt caggccgggt tgggacaaag gcatattggc tccaatccta       660
     gcttaccatc gccgaaccaa gtctcctttc atggttaacc cgtaccctta ctttggtttt       720
     gaccccaaaa acgtcaactt cgcaattttc cgaacaccgt acaaggcagt ccgtgacccg       780
     ttcacccgcc acgtctacac caacatgttt gatgcactca tggactcgac atactcagcc       840
     atgaaagctc ttggatacgg tgatgttaac attgtcgttg gcgagactgg ctggccatct       900
     gcttgtgacg caccttggtg ctcgcctgcg aatgctgctt ggttcaacct caacattatc       960
     aaacgtgcac aaggccaagg gacacctctc atgcctaaca gacggttcga gacatacatt      1020
     ttcggtctct tcaacgaaga aggcaaaccc ggtccgaccg cagagcgtaa ctggggactt      1080
     ttccgagcag atttctcccc ggtttacgat gttggtcttc tccgaaacgg acaaggcggt      1140
     ggaggccgcc cagcattgcc cgcacctagt actgccggcg gtaaatggtg tgtagcgagg      1200
     tccggggcga cgaatactca gctgcaagac agtattaatt gggtgtgtgg tcagggtgtt      1260
     gactgtaaac cgatccaagc tggtggttcg tgctttaacc cgagcagttt gaggacgcac      1320
     gcatcttttg ttatgaatgc ttatttccag agccacggcc gcactgatgg tgcttgtaac      1380
     ttcagtggaa ctggtatgat cgtagggaac aacccaagca atggtgcatg taagtactaa      1440
     ggagattgtc tatgtagtag tatttgtctg gaaagtccta acataatggt tctgaggaac      1500
     tttggatttg agagatcatc agctttgtgt ttaatttcgg attatcctaa ttttaagatt      1560
     tttttgtc                                                               1568
//