spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY086991; SV 1; linear; mRNA; STD; PLN; 661 BP.
XX
AC   AY086991;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 5)
XX
DE   Arabidopsis thaliana clone 30238 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
OC   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
XX
RN   [1]
RP   1-661
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-661
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-661
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..661
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="30238"
FT                   /db_xref="taxon:3702"
FT   CDS             17..520
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:Q8LBU2"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LBU2"
FT                   /protein_id="AAM64552.1"
FT                   /translation="MATKEPESVYELSIEDAKGNNLALSQYKDKVLLIVNVASKCGMTN
FT                   SNYTELNELYNRYKDKGLEILAFPCNQFGDEEPGTNDQITDFVCTRFKSEFPIFNKIEV
FT                   NGENASPLYKFLKKGKWGIFGDDIQWNFAKFLVDKNGQAVQRYYPTTSPLTLEHDIKNL
FT                   LNIS"
XX
SQ   Sequence 661 BP; 212 A; 123 C; 128 G; 198 T; 0 other;
     attttcccag tgagaaatgg cgacgaagga accagaatct gtttacgagt taagcatcga        60
     ggatgcaaaa gggaacaact tagcactcag tcaatacaaa gacaaagttc ttttaattgt       120
     caatgttgct tccaaatgtg ggatgacaaa ctcaaactac actgaattga atgagcttta       180
     caacaggtat aaagataaag gtctggagat tctagcattt ccttgtaacc agtttggtga       240
     cgaggaaccg ggaactaatg accaaattac tgactttgtt tgtactcgct tcaaatctga       300
     attccccatt ttcaacaaga ttgaagtaaa cggagagaat gcttctcctc tgtataagtt       360
     cctgaagaaa ggcaaatggg gaatcttcgg cgatgacatt caatggaact ttgctaagtt       420
     tcttgttgac aaaaacggtc aagctgtaca acgttattat ccaactactt cccctcttac       480
     acttgagcat gacataaaga atcttctgaa tatctcctga atgatgaagc tttgttgctg       540
     aatcgtattg tatttgatta tgaacctctc tcattcaata aagagccatg acattgactt       600
     ggattgatta gttctgtttg agagccaaat cggttattta gataaaccag cattattatc       660
     c                                                                       661
//
spacer
spacer