EBI Dbfetch

ID   AY086423; SV 1; linear; mRNA; STD; PLN; 1608 BP.
XX
AC   AY086423;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 25053 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
OC   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
XX
RN   [1]
RP   1-1608
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-1608
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-1608
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1608
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="25053"
FT                   /db_xref="taxon:3702"
FT   CDS             145..1449
FT                   /codon_start=1
FT                   /product="putative glycosylation enzyme"
FT                   /db_xref="GOA:Q9LFQ0"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFQ0"
FT                   /protein_id="AAM63425.1"
FT                   /translation="MKKLKSYYMQVRNQQQSLDRKWILPLAIGSICSLFLLLLTNLASS
FT                   SGQTRLIPFSVYGFRSSVFVESKINPVSVSLTVSVSPPPPPRLAYLISGSSGDGQMLKR
FT                   TLMALYHPNNQYVVHLDRESSPEERLDLSGFVANHTLFQRFQNVRMIVKANFVTYRGPT
FT                   MVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSYLPRDLNFIDHTSNIG
FT                   WKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAWMMLSRPFVDYFIWG
FT                   WDNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNSDLHFISWDNPPKQHPHHLT
FT                   LDDFQRMVDSNAPFARKFRRDEPVLDKIDSELLFRSHGMVTPGGWCIGTRENGSDPCAV
FT                   IGDTSVIKPGLGAKRIEKLITYLLSTENFRPRQCR"
XX
SQ   Sequence 1608 BP; 428 A; 342 C; 327 G; 511 T; 0 other;
     aacaaacaaa caaaaacaca ccaattcctt cattcatctt ctccatttcg taattcgtac        60
     acttcactct caagtctctc taagccacaa accactgaag aagaatccat ctaagagctg       120
     ttaaaaattg atgaagcttc gaatatgaag aaattgaaaa gctattacat gcaagttcgt       180
     aaccagcaac aatctcttga ccgaaaatgg attcttccat tagcaatcgg atccatttgt       240
     tctctgtttc tcttgttgct aacgaactta gcttcttctt ctggtcaaac tcgtttgatt       300
     ccattttcag tttacggatt tagatcctcc gtcttcgtcg aatccaagat aaatccagta       360
     tccgtctcac tcaccgtctc cgtctctcct cctccgccgc cacgtctcgc ttatctaatc       420
     tccggctcct ctggtgacgg tcagatgctg aaacgaactc taatggcgct ttatcatccc       480
     aacaaccagt acgttgttca tctcgatcgg gaatcttcac cggaggaacg attggatctc       540
     agtggttttg tggcgaatca tactctgttt cagagatttc aaaatgttcg gatgattgtt       600
     aaggctaatt tcgttacgta tcgtggtcca actatggtgg ctaatacact tcacgctgca       660
     gcgattttgc ttcgtgaagg tggtgattgg gattggttca tcaatctcag tgcctctgat       720
     tatcctctcg taacacaaga tgatctgttg catacgtttt cgtatcttcc tcgagatctc       780
     aatttcatcg atcatacaag caacattggc tggaaagagt ctcatagagc aaagcctata       840
     attattgatc ctggtttgta tatgtcaaag aaagctgatg ttttctgggt ttcacagaag       900
     agaagtatgc ctacagcttt caaactcttc acaggatctg cgtggatgat gttatctaga       960
     ccttttgtgg attatttcat atggggatgg gataatcttc ctcgaattgt gttaatgtat      1020
     tacgcaaact tcctttcatc gccagaaggt tacttccaca ctgtgatttg caatgctcga      1080
     gagtttacca acacaacggt taacagtgac ttacatttca tctcatggga caatcctcca      1140
     aagcaacatc ctcaccatct tacattagat gatttccaga gaatggtgga cagtaacgct      1200
     ccttttgcta ggaaattccg tagagatgag cctgttctcg ataagattga ttcggaacta      1260
     ttgtttcgga gtcacgggat ggtcactccg ggtggttggt gtattggtac gagggaaaac      1320
     gggagcgatc cgtgtgcggt gattggtgat acgtcggtta ttaaacctgg tcttggagct      1380
     aaacggatcg agaaactcat aacttatttg ttatctactg agaatttcag accacggcaa      1440
     tgccggtaat ggcaaattag agttttgtca tagagatggt tacgtggttt ttcacacaaa      1500
     tgaactgtat tgattatccg atactttgat atggttgtat agagatcttt ttggactttc      1560
     ttcatttgag aaagtgcaga aatttcggga aagatcattg attattgc                   1608
//