EBI Dbfetch

ID   AY085203; SV 1; linear; mRNA; STD; PLN; 1078 BP.
XX
AC   AY085203;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 13806 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
OC   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
XX
RN   [1]
RP   1-1078
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-1078
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-1078
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1078
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="13806"
FT                   /db_xref="taxon:3702"
FT   CDS             82..840
FT                   /codon_start=1
FT                   /product="6-phosphogluconolactonase-like protein"
FT                   /db_xref="GOA:Q8LEV7"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEV7"
FT                   /protein_id="AAM61753.1"
FT                   /translation="MAQRKMIVFPTKNELSEAMAEYTANLSAKFIKEKGLFTVVLSGGD
FT                   LIDWLCKLVQPPYIDSIEWSKWHVFWVDERVCAWEDPDSNYKLAMEGFLSKVPIPDKNI
FT                   YAIDKHLAADGNAEHCATLYEECLKNLVKEKIIPISKKTGYPEFDLQLLGMGPDGHMAS
FT                   LFPNHPQINEKQKWVTYITDSPKPPPKRITFTLPVINSTLYNLMAICDKAPAKSVAEIM
FT                   KHNNLSLPSAHLSAQVENVWYLDQAAASEL"
XX
SQ   Sequence 1078 BP; 299 A; 243 C; 223 G; 313 T; 0 other;
     acaacaacaa tatgcacatt cttcttcttt tgagtattac atccaacgaa acgtctcttt        60
     ctttctctct gataggcaac aatggcgcag aggaagatga ttgtgtttcc caccaagaat       120
     gaattgtccg aagcaatggc tgagtacact gccaatctct ccgccaagtt catcaaagag       180
     aaaggccttt tcaccgttgt tctctccggc ggtgacctaa tcgattggct ctgcaagttg       240
     gtgcaacctc cttatattga ttcaatcgaa tggtcaaaat ggcacgtctt ttgggtcgat       300
     gagagggttt gtgcatggga agatccagac agtaactaca aactcgccat ggagggtttt       360
     ctctctaagg ttccgattcc ggataagaac atctacgcaa tcgacaagca cttggcggct       420
     gatggtaacg ccgagcactg cgcgacgctc tacgaggagt gtctaaagaa tctggtgaaa       480
     gaaaagatta tcccaatatc gaaaaagaca gggtatcctg agtttgatct acaacttcta       540
     gggatgggtc ctgatggcca catggcgtct ctcttcccaa accatccaca gatcaatgag       600
     aagcagaaat gggtcactta catcaccgac tctccaaaac caccaccaaa gagaatcaca       660
     ttcactttac cggtcatcaa ctctactttg tacaatctta tggccatttg tgacaaagca       720
     ccggccaaat ccgtggctga gatcatgaag cacaacaacc tctcgttacc ttctgctcat       780
     cttagtgctc aagtcgaaaa tgtttggtac cttgaccaag cagctgcctc cgagctctag       840
     agagctagcc taaacacatt aatattggtg ttttgtttgt agtctctacg ttgctttgtg       900
     ttgaataacc ggttaataca tttgcgtacg tttacttcgt acaaaatgtg ttgaatattc       960
     gagctagttg tttcttgtag ttgtgatgtg agtccctggc tatgactata tatcattata      1020
     aaaatatata gtgggcttca tttaatctgt catttcatga atggtgttta attaaact        1078
//