![]() |
EBI DbfetchID AY084812; SV 1; linear; mRNA; STD; PLN; 1172 BP. XX AC AY084812; XX DT 14-JUN-2002 (Rel. 72, Created) DT 24-FEB-2006 (Rel. 86, Last updated, Version 5) XX DE Arabidopsis thaliana clone 118484 mRNA, complete sequence. XX KW FLI_CDNA. XX OS Arabidopsis thaliana (thale cress) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids II; Brassicales; Brassicaceae; Arabidopsis. XX RN [1] RP 1-1172 RX PUBMED; 12093376. RA Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N., RA Feldmann K.A., Flavell R.B., White O., Salzberg S.L.; RT "Full-length messenger RNA sequences greatly improve genome annotation"; RL Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002). XX RN [2] RP 1-1172 RA Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.; RT "Features of Arabidopsis genes and genome discovered using full-length RT cDNAs"; RL Plant Mol. Biol. 60(1):71-87(2006). XX RN [3] RP 1-1172 RA Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.; RT ; RL Submitted (11-MAR-2002) to the EMBL/GenBank/DDBJ databases. RL Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA XX CC This clone sequence is one of 5,000 Ceres full-length cDNAs made CC available to TIGR and Genbank. The following quality assessment of CC this set was done by comparison with known proteins: two percent of CC the clones are estimated to be 5'-truncated; less than one percent CC are 3'-truncated; approximately two percent represent alternative CC splice variants, including unspliced introns and spliced exons; one CC percent may contain premature stop codons; five percent may have CC frame shifts in a coding region. A sequence is considered to be CC 5'-truncated if it lacks the translation initiation start (ATG). A CC sequence is considered to be 3'-truncated if it lacks the CC C-terminal end of the encoded protein. Please note that these cDNA CC sequences are derived from the Ws or LAer ecotypes and therefore CC may contain polymorphisms when compared to sequences from Col-0. CC Genset carried out the library production and sequencing of the CC full-length clones. Ceres, Inc. carried out the clustering of the CC 5' sequences, selection of clones, and sequence assembly. XX FH Key Location/Qualifiers FH FT source 1..1172 FT /organism="Arabidopsis thaliana" FT /mol_type="mRNA" FT /clone="118484" FT /db_xref="taxon:3702" FT CDS 47..1003 FT /codon_start=1 FT /product="unknown" FT /db_xref="GOA:Q8LFJ4" FT /db_xref="InterPro:IPR002659" FT /db_xref="UniProtKB/TrEMBL:Q8LFJ4" FT /protein_id="AAM61378.1" FT /translation="MKSSPRSEGRKFIIPSFFFIIALCVLAFINGIRFDSLLSFGRCAL FT SNVPMNNGSSETPLLSSSPVDDEIRILIGILTLPDQYSRRHFLRMIYGTQNVPDGVKVD FT VKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDIFNETDAQK FT PPYHYVMKADDDTYIRLESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSW FT DIAVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELW FT PDTIAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYHIP" XX SQ Sequence 1172 BP; 340 A; 224 C; 228 G; 380 T; 0 other; tttcctctgc ttctcaacat ctctaagctt tcattgaaca aggaatatga aatcttctcc 60 aagatcagaa ggaagaaagt tcattatccc ttctttcttc ttcatcatag ctctttgtgt 120 actagctttc atcaacggga tcagattcga tagcttattg agttttggaa gatgtgcttt 180 gtcaaatgtt cctatgaata atggttcatc agagactcca ttgttgtctt cttctcctgt 240 tgatgatgag attaggattc ttattggaat ccttacactt cctgatcagt attcacgtcg 300 ccattttctc cggatgatct acgggacaca aaatgttccg gacggtgtta aggttgatgt 360 gaagtttgtg ttctgtaatt tgactaaaga agaccagaaa gtgcttgttg ctttggagat 420 tatgcgttat gatgacatca ttatactcaa ctgcaatgag aatatgaaca aaggcaagac 480 ttacacatac ttctcaagct taccagacat attcaatgag accgatgcac aaaaaccacc 540 gtaccattac gtaatgaaag ccgacgacga cacatacata agactagaaa gtctcgttgc 600 atctttgaga ccactccctc gagaagatct ttactacggc tatgtaattc catgtccaag 660 catggaccca tttgttcatt acatgtcagg aatgggttac ttagtgtcat gggatattgc 720 ggtttggctc aaagactcgg aaattcccaa gaaacatcta gaaggtcctg aagacaaagt 780 gtttggcgat tggattcgag aaggaagacg aggaaaaaac cggtttaacg ctaagtggtc 840 catgtataat ttccctgagc caccgactag atgcacacat gagctttggc cagacactat 900 tgccgttcat ttgttaaaga accaagagaa gtggatacgt acattgaact atttcaatgt 960 tactagcaat ctcaagcctt ctaaactata ccacataccg tagatagtct ttttgtttgc 1020 ttttaccgga ttcttatatt tatactttac attgtttctc ttgaaattgg taagaaatgt 1080 tctttaataa tcgatttttt gggagggatt tgtagtacac taattaagga ttgttcaaac 1140 atgtttaata gtcaatctgg ttgggttttt tc 1172 // ![]() |