spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY084803; SV 1; linear; mRNA; STD; PLN; 577 BP.
XX
AC   AY084803;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 11830 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
OC   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
XX
RN   [1]
RP   1-577
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-577
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-577
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..577
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="11830"
FT                   /db_xref="taxon:3702"
FT   CDS             66..425
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FKH4"
FT                   /protein_id="AAM61369.1"
FT                   /translation="MSTFLIRILLPLLIIAMTLPRRSEAESEQWCIADEQTPDDELQAA
FT                   LDWACGKGGADCSKMQQENQPCFLPNTIRDHASFAFNSYYQTYKNKGGSCYFKGAAMIT
FT                   ELDPSHGSCQYEYNP"
XX
SQ   Sequence 577 BP; 174 A; 137 C; 108 G; 158 T; 0 other;
     aaacttccta actagataga tcagatctgg atctctctgc accactcatt gccttctcta        60
     gaaacatgtc aactttcttg ataaggatac ttcttccttt gcttatcata gcaatgactc       120
     ttcctcgacg ttcagaggca gagtcggaac aatggtgcat agcggatgaa caaacgccag       180
     acgatgagtt gcaagcagcc ttagactggg cttgcggaaa aggtggagca gactgcagca       240
     aaatgcagca ggaaaaccag ccttgcttct tgcctaacac aatcagagat catgcctcct       300
     ttgctttcaa cagttactac caaacttata aaaacaaagg tggttcttgt tacttcaaag       360
     gagctgccat gatcactgag cttgacccca gccatggttc ttgccagtat gagtataacc       420
     cctgattcaa acgacacagc aaagacaaga tacagcaaga tgaaaagcta tgattttgca       480
     tttatacgtt ttctctatgt aatgttttca ttccaaagca gtatccatgt actgttctcc       540
     cattacactc cagtctgaga taaaaatttc ttcaacg                                577
//
spacer
spacer