EBI Dbfetch

ID   AY084439; SV 1; linear; mRNA; STD; PLN; 1260 BP.
XX
AC   AY084439;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 108322 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
OC   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
XX
RN   [1]
RP   1-1260
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-1260
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-1260
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1260
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="108322"
FT                   /db_xref="taxon:3702"
FT   CDS             265..1254
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:Q8LG66"
FT                   /db_xref="InterPro:IPR015338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LG66"
FT                   /protein_id="AAM61012.1"
FT                   /translation="MGVKSVRFSIWFLFVVTDLVFCRTLSGDPDPCDATNQREFQKLRS
FT                   DQITVLINGYSEYRIPLLQTIVASYSSSSIVSSILVLWGNPRTPDQLLDQLYQNLTQYS
FT                   PGSASISLIQQSSSSLNARFLPRSSVDTRAVLICDDDVEIDQRSLEFAFSVWKSNPDRL
FT                   VGTFVRSHGFDLQGKEWIYTVHPDKYSIVLTKFMMMKQDYLFEYSCKGGVEMEEMRMIV
FT                   DQMRNCEDILMNFVAADRLRAGPIMVGAERVRDWGDARNEEVEERVRDVGLSSRRVEHR
FT                   KRRGNCIREFHRVMGKMPLMYSYGKVVNSVGEQGLCRKAGKLVFCDRD"
XX
SQ   Sequence 1260 BP; 335 A; 244 C; 322 G; 359 T; 0 other;
     atgagagccg ttaattagcc tctaaccgcc gaagatgatg gtcaactcca actagtcaat        60
     cggaattcca aatctctaga cggagattct gatgccggaa tgccatcagc ttccgaggta       120
     attttctctt tgcctgtttg ttgacataga cacacacacg cttataggaa acgaaattgc       180
     gatccatcct cgaatgctac atccatcgct cttctctgtt ttatcgatca aatcggaact       240
     aactgatagg atagttaggc tgatatggga gtcaaatcgg tgaggttctc tatctggttc       300
     cttttcgttg ttacggatct cgtgttttgt cgcacgctct caggggatcc agatccatgt       360
     gatgcaacga accagagaga atttcaaaaa ctcagatcgg atcagatcac cgttctaatc       420
     aacggttact cagaataccg gattcctctt ctgcaaacca tcgtggcctc ttattcttca       480
     tcctcgatcg tatcctccat cttagtccta tggggtaacc ctagaacacc tgatcaacta       540
     cttgaccagt tgtatcagaa tctgactcag tattcgcctg gttctgcttc catctctcta       600
     attcagcaat cttcgagcag cctcaacgct agattcctcc ctcgttcctc tgtagacact       660
     cgtgctgttt tgatatgtga tgatgacgtc gagattgacc agagatcgtt ggagtttgcg       720
     ttttcagtgt ggaagtcgaa tcctgatcgc cttgtaggaa cgtttgtgag gtcacacggt       780
     ttcgatttgc aggggaaaga gtggatatac actgttcatc cagataaata ctcgattgtg       840
     ttgaccaagt tcatgatgat gaaacaggat tatctgtttg agtatagctg caagggaggt       900
     gtggagatgg aggagatgag gatgattgtg gaccaaatgc gtaactgcga ggatatactg       960
     atgaattttg tagctgcaga taggttaagg gcagggccaa tcatggttgg agctgagaga      1020
     gttagggatt ggggagatgc gcgtaacgaa gaagtagaag agagagtaag agacgtggga      1080
     ttgagcagta gaagagtgga acataggaag agaagaggga attgcattag ggagtttcat      1140
     agagttatgg ggaagatgcc attgatgtat agttatggta aagttgttaa ctctgttggg      1200
     gaacaaggat tgtgtcgtaa agccggcaaa cttgtctttt gtgatcgaga ttgacagcct      1260
//