![]() |
EBI DbfetchID AY070679; SV 1; linear; mRNA; STD; INV; 536 BP. XX AC AY070679; XX DT 22-DEC-2001 (Rel. 70, Created) DT 16-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Drosophila melanogaster RH17440 full length cDNA. XX KW FLI_CDNA. XX OS Drosophila melanogaster (fruit fly) OC Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; OC Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; OC Drosophilidae; Drosophila; Sophophora. XX RN [1] RP 1-536 RA Stapleton M., Brokstein P., Hong L., Agbayani A., Carlson J., Champe M., RA Chavez C., Dorsett V., Dresnek D., Farfan D., Frise E., George R., RA Gonzalez M., Guarin H., Kronmiller B., Li P., Liao G., Miranda A., RA Mungall C.J., Nunoo J., Pacleb J., Paragas V., Park S., Patel S., RA Phouanenavong S., Wan K., Yu C., Lewis S.E., Rubin G.M., Celniker S.; RT ; RL Submitted (18-DEC-2001) to the EMBL/GenBank/DDBJ databases. RL Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, RL One Cyclotron Road, Berkeley, CA 94720, USA XX CC Sequence submitted by: CC Berkeley Drosophila Genome Project CC Lawrence Berkeley National Laboratory CC Berkeley, CA 94720 CC This clone was sequenced as part of a high-throughput process to CC sequence clones from Drosophila Gene Collection 1 (Rubin et al., CC Science 2000). The sequence has been subjected to integrity checks CC for sequence accuracy, presence of a polyA tail and contiguity CC within 100 kb in the genome. Thus we believe the sequence to CC reflect accurately this particular cDNA clone. However, there are CC artifacts associated with the generation of cDNA clones that may CC have not been detected in our initial analyses such as internal CC priming, priming from contaminating genomic DNA, retained introns CC due to reverse transcription of unspliced precursor RNAs, and CC reverse transcriptase errors that result in single base changes. CC For further information about this sequence, including its location CC and relationship to other sequences, please visit our Web site CC (http://fruitfly.berkeley.edu) or send email to CC cdna@fruitfly.berkeley.edu. XX FH Key Location/Qualifiers FH FT source 1..536 FT /organism="Drosophila melanogaster" FT /strain="y; cn bw sp" FT /mol_type="mRNA" FT /db_xref="taxon:7227" FT CDS 11..469 FT /codon_start=1 FT /product="RH17440p" FT /note="Longest ORF" FT /db_xref="FLYBASE:FBgn0029765" FT /db_xref="GOA:Q9W4C2" FT /db_xref="HSSP:1GD6" FT /db_xref="InterPro:IPR001916" FT /db_xref="InterPro:IPR019799" FT /db_xref="UniProtKB/TrEMBL:Q9W4C2" FT /protein_id="AAL48150.1" FT /translation="MRAAPFGSWYWLGLGLGLLLAIECGVVSAKRFLRCELARKLLDQH FT GFERSLLSNWICLLEHESDLDTGRITTNANGSRNYGLFQINGRFCQEGRRGGICNAKCE FT DFLDENLRESVTCAKRIQTSDGFRHWAGWQRYCRNAQNLPNLKVICGI" XX SQ Sequence 536 BP; 142 A; 105 C; 146 G; 143 T; 0 other; gagtcgcaat atgagagctg cgccattcgg atcgtggtac tggctgggat tgggattggg 60 cctgcttctg gccatcgagt gcggcgtggt ttccgccaag cgtttcctgc gctgtgaact 120 ggcccgcaag ttgctcgatc agcatggttt cgaacgcagt ctgctctcga attggatttg 180 tttgctagag cacgaaagcg atctggatac cggcaggatt acaaccaatg cgaatggatc 240 tcggaactat gggctgttcc aaatcaatgg caggttttgt caggagggaa ggcgtggcgg 300 catttgcaat gccaagtgcg aagatttttt ggacgaaaat ttaagggagt cggttacttg 360 cgccaagcgc atccaaacct cggatggttt tcgtcattgg gcgggatggc aacgatattg 420 ccgaaacgcc caaaatctgc ctaatcttaa ggttatctgt gggatctaga tgtaattaat 480 ttaatgattt caatttgtaa caaataaata ttatatatgc aaaaaaaaaa aaaaaa 536 // ![]() |