![]() |
EBI DbfetchID AJ575657; SV 1; linear; mRNA; STD; VRT; 1362 BP. XX AC AJ575657; XX DT 09-JUL-2003 (Rel. 76, Created) DT 20-NOV-2003 (Rel. 77, Last updated, Version 2) XX DE Gallus gallus partial mRNA for putative protein-O-fucosyltransferase (FUT13 DE gene), clone 2 XX KW FUT13 gene; protein-O-fucosyltransferase. XX OS Gallus gallus (chicken) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; OC Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. XX RN [1] RP 1-1362 RA Oriol R.; RT ; RL Submitted (07-JUL-2003) to the EMBL/GenBank/DDBJ databases. RL Oriol R., U504, Inserm, 16 Av. Paul Vaillant-Couturier, 94807, FRANCE. XX RN [2] RA Martinez-Dunker I., Mollicone R., Candelier J.J., Breton C., Oriol R.; RT "A new superfamily of protein-O-fucosyltransferases, RT alpha2-fucosyltransferases, and alpha6-fucosyltransferases: phylogeny and RT identification of conserved peptide motifs"; RL Glycobiology 13(12):1c-5c(2003). XX DR Ensembl-Gn; ENSGALG00000000579; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000002850; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000003693; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000004351; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000004653; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000005202; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000005247; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006141; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000007423; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000021511; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000000809; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000002030; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000002034; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000004494; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000005857; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000006942; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000007414; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000008352; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000008429; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000009916; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000012007; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039623; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000040604; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000040605; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000040618; Gallus_gallus. XX FH Key Location/Qualifiers FH FT source 1..1362 FT /organism="Gallus gallus" FT /mol_type="mRNA" FT /clone="2" FT /db_xref="taxon:9031" FT CDS <1..1143 FT /codon_start=1 FT /gene="FUT13" FT /product="putative protein-O-fucosyltransferase" FT /function="adds fucose to serine or threonine in FT glycoproteins" FT /db_xref="InterPro:IPR019378" FT /db_xref="UniProtKB/TrEMBL:Q7T1N6" FT /protein_id="CAE02610.1" FT /translation="VNPPEGFNLRRDVYIRIASLMKTLLKSENWVLVLPPWGRLYHWQS FT PDILQVRIPWSEFFDLPSLNKNIPVIEYEQFLAESGGPFIEQIYVLQGYEEGWKEGTWE FT EKIDERPCIDQLMYSKDKHQYYRGWFWGYEETRGLNVSCLSVQGSASVVAPILLKNTSA FT QSVMLDRAENLLHDHYGGKDYWNTRRSMVFAKHLRVAGDEFRNKYLQSTDEADRTHYNE FT DWTQMKVKTGTALGGPYLGVHLRRKDFIWGHREDVPSLHGAAKKIHSLLKTHKLEKVFI FT ATDAVEDEIELLKKLVPEMVRFEPTWEELELYKDGGMAVIDQWICAHARYFIGTSVSTF FT SFRIHEEREILGFDPKTTYNRFCGEKEKNCEQPTHWKIVY" XX SQ Sequence 1362 BP; 404 A; 263 C; 336 G; 359 T; 0 other; gtaaatcctc ctgaagggtt caaccttcgc agggatgtct atattcgtat tgcttcactt 60 atgaagactt tgctgaaaag tgaaaattgg gtgttagttc tgccaccgtg gggacgtctc 120 tatcactggc agagtcctga catccttcag gtccgaatcc cttggtctga gttctttgac 180 ctcccaagcc ttaataagaa catccctgtc atcgagtatg agcagttcct tgcagagtca 240 ggtgggccct ttattgagca gatttatgtc ctgcaaggct atgaggaagg atggaaagaa 300 ggaacatggg aagaaaaaat agatgagaga ccttgcattg atcagcttat gtattccaaa 360 gacaagcatc agtactacag gggatggttc tggggttatg aggaaacacg gggcctgaat 420 gtctcctgct tgtctgttca aggatctgcc tctgttgtag cccctatcct tctgaagaat 480 acctcagcac agtcagtgat gttggacaga gctgaaaacc ttcttcatga ccactatgga 540 gggaaagatt attggaatac ccgtcgaagt atggtatttg ctaaacatct ccgtgtagca 600 ggagatgagt ttagaaacaa gtaccttcag tccacagacg aggcagacag gactcattac 660 aatgaggact ggacacagat gaaggttaag acaggcacag ctctaggtgg tccatacctt 720 ggggttcatc tcagaaggaa agatttcatc tggggtcaca gagaagatgt gccttccctg 780 cacggagcag caaagaaaat ccacagcctc ttgaaaacgc ataaacttga aaaagttttc 840 atagccactg atgctgttga ggatgagatt gaattgctca agaaactggt gcctgagatg 900 gtgaggtttg aacctacttg ggaggagcta gaactgtaca aagatggggg aatggctgtg 960 attgaccagt ggatctgtgc acatgctagg tattttatag gcacctcagt ttcaacattt 1020 tcctttcgga ttcatgagga aagggagatc ttgggatttg atccaaaaac aacttacaat 1080 cgattctgtg gtgaaaaaga gaaaaactgt gagcagccaa ctcactggaa aattgtatac 1140 tagtatacag agaaatccaa gggctttata ctggtgagct caaaagaaaa aggaaagtct 1200 atggggaaga acatcccttc aatgaaacta gaactcagtc ttcaccttct gtgattcgtg 1260 ctgtttactt gatgtttggg ctttgaaaca caagcaatat ttatcctctt attcaggcac 1320 tgatgggagc aaggaaaatg aagttatcct tggattcaaa aa 1362 // ![]() |