![]() |
EBI DbfetchID AJ567375; SV 1; linear; mRNA; STD; VRT; 1194 BP. XX AC AJ567375; XX DT 18-JUN-2003 (Rel. 76, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 3) XX DE Gallus gallus partial mRNA for putative beta3-glucuronyltransferase (b3gat1 DE gene), clone 1 XX KW 3-beta-glucuronosyltransferase; b3gat1 gene; GlcAT-P; HNK1 epitope. XX OS Gallus gallus (chicken) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; OC Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. XX RN [1] RP 1-1194 RA Oriol R.; RT ; RL Submitted (17-JUN-2003) to the EMBL/GenBank/DDBJ databases. RL Oriol R., U504, INSERM, 16 Av. Paul Vaillant-Couturier, 94807, FRANCE. XX RN [2] RA Martinez-Duncker I., Mollicone R., Candelier J.J., Codogno P., Oriol R.; RT "Phylogeny of beta3-glucuronyltransferases"; RL Unpublished. XX DR Ensembl-Gn; ENSGALG00000000672; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000000996; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000001611; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000002015; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000002020; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006609; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000000949; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000001472; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000002453; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000003136; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000003144; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000010668; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000034500; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000040969; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000041197; Gallus_gallus. XX FH Key Location/Qualifiers FH FT source 1..1194 FT /organism="Gallus gallus" FT /mol_type="mRNA" FT /clone="1" FT /db_xref="taxon:9031" FT CDS <244..>1194 FT /codon_start=1 FT /gene="b3gat1" FT /product="3-beta-glucuronosyltransferase" FT /function="synthesis of the HNK1 epitope" FT /db_xref="GOA:Q7T180" FT /db_xref="HSSP:1FGG" FT /db_xref="InterPro:IPR005027" FT /db_xref="UniProtKB/TrEMBL:Q7T180" FT /protein_id="CAD98792.1" FT /translation="MPKRRDILAIVLIVLPWTLLITVWHQSTIAPLLAVHKDDGGDSRR FT DLAAGLDSKEYCLSDRDIVEVVRTEYVYTRPPPWSDTLPTIHVITPTYSRPVQKAELTR FT LANTLLHVPNLHWILVEDSQRRTPLITRLLRDTGLNYTHLNVETPRNYKLRGDMRDPRI FT PRGTMQRNLALRWLRETFNKNNSQPGIVYFADDDNTYSLELFEEMRSTRKVSVWPVAFV FT GGLRYESPKVNAAGKVYGWKTVFDPHRPFAIDMAGFAVNLRLILQRSQACFKLRGVKGG FT YQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKP" XX SQ Sequence 1194 BP; 268 A; 343 C; 343 G; 240 T; 0 other; gattagagca tgaatgggag cagcctccca gccacgatgg agagagaagg cggttcagac 60 tgtgggaata aggtttcctg ccagatgggt gcctgaggtt cctgctggag gccccaacag 120 catcccgtag aagtgctctc ctgcttctgg tcccagcagc tgaggcccct ccaaacctgc 180 ttctgcaatg ggtgggttgt aagcactggt aatgaggagc tgtgggtcca gtcagtcttg 240 gagatgccga agagacgaga catcctggct atcgtgctga tagttctgcc ctggacacta 300 ctaatcaccg tctggcacca gagcaccatt gctccactgc ttgcagtgca caaggatgat 360 ggtggtgact cccggcgtga tctcgctgca ggcttggact ccaaggaata ctgcttgtcg 420 gaccgggaca ttgtggaggt ggtgaggaca gaatatgttt atactcgccc acccccgtgg 480 tcagacaccc ttcccactat ccacgtcatt acacccacct acagccggcc cgtgcagaaa 540 gcagagctga cgcgcctggc caacaccctc ctgcatgtgc caaacctgca ctggatcctg 600 gtggaggact cccagcggcg cacacccctc atcacccggc tgctacggga cacggggctc 660 aactacaccc acctcaacgt ggagacccct cgcaactaca agctgcgggg agacatgagg 720 gacccccgca tcccccgggg gaccatgcag aggaaccttg ccctgaggtg gctgagagag 780 acctttaaca aaaacaacag tcagcctggg attgtttact ttgctgatga tgataacacc 840 tacagcctgg agctcttcga ggagatgcgc agcaccagaa aggtgtcggt gtggccagta 900 gccttcgttg gtggcttgcg ctacgagtcc cccaaagtga atgctgcagg gaaggtctac 960 ggctggaaaa ctgtgtttga cccccatcgc ccctttgcta tagacatggc agggtttgct 1020 gtgaacctca ggctgatcct tcagcgatct caggcgtgct tcaagctgcg aggagtgaag 1080 ggaggctacc aggagagcag cctgctgcgg gagctggtca ccctgaacga ccttgagcca 1140 aaagctgcca attgcactaa gattttagtt tggcataccc ggaccgagaa gccc 1194 // ![]() |