![]() |
EBI DbfetchID AJ295994; SV 1; linear; mRNA; STD; PLN; 422 BP. XX AC AJ295994; XX DT 06-JAN-2003 (Rel. 74, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Nicotiana tabacum partial mRNA for N-acetylglucosaminyltransferase I (gnTI DE gene) XX KW GntI gene; N-acetylglucosaminyltransferase I. XX OS Nicotiana tabacum (common tobacco) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; OC asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; OC Nicotiana. XX RN [1] RP 1-422 RA Steinkellner H.; RT ; RL Submitted (20-SEP-2000) to the EMBL/GenBank/DDBJ databases. RL Steinkellner H., Universitiy of Agricultural Sciences-Vienna, Center of RL Applied Genetics, Muthgasse 18, 1190 VIenna, AUSTRIA. XX RN [2] RA Strasser R., Glossl J., Steinkellner H.; RT "Less than 2% of GnTI activity does not alter N-glycosylation in Nicotiana RT benthamiana"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1..422 FT /organism="Nicotiana tabacum" FT /mol_type="mRNA" FT /db_xref="taxon:4097" FT CDS <1..>422 FT /codon_start=1 FT /gene="gnTI" FT /product="N-acetylglucosaminyltransferase I" FT /db_xref="GOA:Q8GUA4" FT /db_xref="HSSP:1FO8" FT /db_xref="InterPro:IPR004139" FT /db_xref="UniProtKB/TrEMBL:Q8GUA4" FT /protein_id="CAC82508.1" FT /translation="MACNRADYLEKTIKSILKYQISVASKYPLFISQDGSHPDVRKLAL FT SYDQLTYMQHLDFGPVHTERPGELIAYYKIARHYKWALDQLFYKHNFSRVIILEDDMEI FT APDFFDFFEAGATLLDRDKSIMAISPWNDNGQMQFV" XX SQ Sequence 422 BP; 119 A; 82 C; 89 G; 132 T; 0 other; atggcttgca atcgggctga ttacctggaa aagactatta aatccatctt aaaataccaa 60 atatctgttg cgtcaaaata tcctcttttc atatcccagg atggatcaca tcctgatgtc 120 aggaagcttg ctttgagcta tgatcagctg acgtatatgc agcacttgga ttttggacct 180 gtgcatactg aaagaccagg ggagctgatt gcatactaca aaattgcacg tcattacaag 240 tgggcattgg atcagctgtt ctacaagcat aattttagcc gtgttatcat actagaagat 300 gatatggaaa ttgcccctga tttttttgac ttttttgagg ctggagctac tcttcttgac 360 agagacaagt cgattatggc tatttctcct tggaatgaca atggacaaat gcagtttgtc 420 ca 422 // ![]() |