![]() |
EBI DbfetchID AJ237770; SV 1; linear; mRNA; STD; INV; 345 BP. XX AC AJ237770; XX DT 01-JUL-1999 (Rel. 60, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Trichuris trichiura mRNA for macrophage migration inhibitory factor-like DE protein XX KW macrophage migration inhibitory factor-like protein; MIF gene. XX OS Trichuris trichiura OC Eukaryota; Metazoa; Nematoda; Enoplea; Trichocephalida; Trichuridae; OC Trichuris. XX RN [1] RC Revised by author 19-MAY-1999 RP 1-345 RA Tan T.H.P.; RT ; RL Submitted (09-APR-1999) to the EMBL/GenBank/DDBJ databases. RL Tan T.H.P., Department of Infectious and Tropical Diseases, London School RL of Hygiene and Tropical Medicine, Keppel Street, London, WC1E 7HT, UNITED RL KINGDOM. XX RN [2] RA Tan T.H.P., Meyer D.J.; RT "Molecular cloning and expression of cDNAs encoding for novel macrophage RT migration inhibitory-like proteins from the parasitic nematodes Trichinella RT spiralis and Trichuris trichiura"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1..345 FT /organism="Trichuris trichiura" FT /mol_type="mRNA" FT /country="Jamaica" FT /dev_stage="adult stage" FT /db_xref="taxon:36087" FT CDS 1..345 FT /transl_except=(pos:19..21,aa:Ser) FT /gene="mif" FT /product="macrophage migration inhibitory factor-like FT protein" FT /function="potential immunomodulator" FT /db_xref="GOA:P81748" FT /db_xref="InterPro:IPR001398" FT /db_xref="InterPro:IPR014347" FT /db_xref="UniProtKB/Swiss-Prot:P81748" FT /protein_id="CAB46355.1" FT /translation="MPIFTFSTNVPSENISVDFLKSTSKLIAGMLGKPESYVAVHINGG FT QKITFGGTDAPAGFGQLLSLGGVGGEKNRSHSAKLFKHLTDGLGIPGNRMYINFVDMRG FT SDVGYNGSTF" XX SQ Sequence 345 BP; 85 A; 82 C; 85 G; 85 T; 8 other; atgccwatyt tyacrttyws nacgaacgtt ccttctgaga acatttccgt cgatttcctg 60 aagagcacaa gcaagttgat agccggtatg ctcggcaaac cagaatcgta cgtcgcagtt 120 catataaacg gtggacaaaa gataacgttt ggtggtaccg acgccccagc tggcttcggg 180 cagttgttgt cgcttggcgg agttggtggc gaaaagaacc gtagtcactc cgccaaacta 240 ttcaagcatt taactgacgg tctcggcatt cctggcaacc gcatgtacat caacttcgtc 300 gacatgcgtg gcagcgatgt tggatacaat gggtcgactt tctaa 345 // ![]() |