![]() |
EBI DbfetchID AF546871; SV 1; linear; genomic DNA; STD; PRO; 666 BP. XX AC AF546871; XX DT 08-NOV-2002 (Rel. 73, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Bacillus licheniformis beta-1-3,1-4-endoglucanase (eg1314) gene, complete DE cds. XX KW . XX OS Bacillus licheniformis OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus. XX RN [1] RC Patent: CN 01134281.8-B 02-NOV-2001; Feed Research Institute, Chinese RC Academy of Agricultural Sciences RP 1-666 RA Wang J.-H., Wu Z.-L., Teng D.; RT "A kind of beta-1,3-1,4-glucanase gene and Bacillus licheniformis EGW039"; RL Unpublished. XX RN [2] RP 1-666 RA Wang J.-H., Wu Z.-L., Teng D.; RT "Cloning of Bacillus licheniformis EGW039 (CGMCC 0635) RT beta-1-3,1-4-endoglucanase gene and its expression in Pichia methanolica"; RL Unpublished. XX RN [3] RP 1-666 RA Wang J.-H., Teng D., Yao Y.; RT ; RL Submitted (13-SEP-2002) to the EMBL/GenBank/DDBJ databases. RL Feed Research Institute, Chinese Academy of Agricultural Sciences, 12 RL Zhongguancun Nandajie St., Haidian District, Beijing 100081, P. R. China XX FH Key Location/Qualifiers FH FT source 1..666 FT /organism="Bacillus licheniformis" FT /mol_type="genomic DNA" FT /db_xref="taxon:1402" FT CDS 10..654 FT /codon_start=1 FT /transl_table=11 FT /gene="eg1314" FT /product="beta-1-3,1-4-endoglucanase" FT /function="to hydrolyze endo-beta-1,3-1,4-glucan in cereal FT seed as barley, oat, wheat, and others" FT /EC_number="3.2.1.6" FT /note="beta-glucanase (1-3),(1-4)-beta-D-glucan FT endoglucanase; lacks signal sequence" FT /db_xref="GOA:Q8GMY0" FT /db_xref="HSSP:1GBG" FT /db_xref="InterPro:IPR000757" FT /db_xref="InterPro:IPR008263" FT /db_xref="InterPro:IPR008264" FT /db_xref="InterPro:IPR008985" FT /db_xref="InterPro:IPR013320" FT /db_xref="UniProtKB/TrEMBL:Q8GMY0" FT /protein_id="AAN64132.1" FT /translation="MQTGGSFFDPFNSYNSGLWQKANGYSNGDMFNCTWRANNVSMTSS FT GEMRLALTSPSYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFFTYTGPTDGTPW FT DEIDIEFLGKDTTKVQFNYYTNGAGNHEKVADLGFDAANAYHTYAFDWQPNSIKWYVDG FT QLKHTATSQIPTTPGKIMMNLWNGIGVDDWLGSYNGVNPLYAHYDWVRFQK" XX SQ Sequence 666 BP; 200 A; 132 C; 159 G; 175 T; 0 other; aatgaattca tgcaaacagg tggatcgttt tttgaccctt ttaacagcta taactccgga 60 ttatggcaaa aagcaaatgg ttactccaat ggagatatgt tcaactgcac gtggcgtgca 120 aataatgtat ccatgacgtc atcaggtgaa atgcgtttgg cgctgacaag cccgtcttat 180 aacaagtttg actgcgggga gaaccgctcc gttcaaacct atggctatgg actttatgaa 240 gtcagaatga aaccggctaa aaacacaggg atcgtttcat cgttcttcac ttatacaggt 300 ccaacggatg gaactccttg ggatgagatt gatattgaat ttttaggaaa agacacgaca 360 aaggttcaat ttaattatta tacaaatggc gcgggaaacc atgagaaggt tgcggatctc 420 ggatttgacg cggccaatgc ctatcatacg tatgcgttcg attggcagcc aaactctatt 480 aaatggtatg tcgatgggca attaaaacat actgcgacaa gccaaatccc gacaacaccg 540 ggaaagatca tgatgaactt gtggaatggg ataggtgtcg atgactggct cggttcctac 600 aatggtgtaa atccgctata cgctcattat gactgggtgc gctttcaaaa atagggatcc 660 gatcgt 666 // ![]() |