![]() |
EBI DbfetchID AF462211; SV 1; linear; mRNA; STD; PLN; 143 BP. XX AC AF462211; XX DT 31-JAN-2002 (Rel. 70, Created) DT 16-DEC-2008 (Rel. 98, Last updated, Version 3) XX DE Narcissus pseudonarcissus putative pectinesterase mRNA, partial cds. XX KW . XX OS Narcissus pseudonarcissus (daffodil) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; Liliopsida; Asparagales; Amaryllidaceae; OC Narcissus. XX RN [1] RP 1-143 RA Hunter D.A., Steele B.C., Reid M.S.; RT "Identification of genes associated with perianth senescence in daffodil RT (Narcissus pseudonarcissus L. 'Dutch Master')"; RL Plant Sci. 163(1):13-21(2002). XX RN [2] RP 1-143 RA Hunter D.A., Reid M.S.; RT ; RL Submitted (26-DEC-2001) to the EMBL/GenBank/DDBJ databases. RL Environmental Horticulture, University of California, One Shields Avenue, RL Davis, CA 95616, USA XX FH Key Location/Qualifiers FH FT source 1..143 FT /organism="Narcissus pseudonarcissus" FT /cultivar="Dutch Master" FT /mol_type="mRNA" FT /tissue_type="4-day old flower tepal" FT /db_xref="taxon:39639" FT CDS <1..>143 FT /codon_start=1 FT /product="putative pectinesterase" FT /db_xref="InterPro:IPR004963" FT /db_xref="UniProtKB/TrEMBL:Q8VWT6" FT /protein_id="AAL69374.1" FT /translation="WFGANSPVIDNMTVAEAVGNWFYDRSSCQKIDCPYPCDTSCINNI FT IP" XX SQ Sequence 143 BP; 31 A; 30 C; 32 G; 50 T; 0 other; tggttcggag ctaattctcc cgttattgat aatatgactg ttgctgaggc agttgggaac 60 tggttttacg atcgtagctc ctgtcagaag atcgactgtc cttatccgtg cgatacttct 120 tgtatcaata acatcattcc ttg 143 // ![]() |