EBI Dbfetch

ID   AF401291; SV 1; linear; mRNA; STD; VRT; 1511 BP.
XX
AC   AF401291;
XX
DT   05-SEP-2001 (Rel. 69, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Gallus gallus putative agmatinase mRNA, complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;
OC   Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
XX
RN   [1]
RP   1-1511
RX   PUBMED; 11804860.
RA   Mistry S.K., Burwell T.J., Chambers R.M., Rudolph-Owen L., Spaltmann F.,
RA   Cook W.J., Morris S.M.Jr.;
RT   "Cloning of human agmatinase. An alternate path for polyamine synthesis
RT   induced in liver by hepatitis B virus";
RL   Am. J. Physiol. Gastrointest. Liver Physiol. 282(2):G375-G381(2002).
XX
RN   [2]
RP   1-1511
RA   Morris S.M.Jr., Kepka-Lenhart D.;
RT   ;
RL   Submitted (21-JUL-2001) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Genetics and Biochemistry, University of Pittsburgh, W1255
RL   Biomedical Science Tower, Pittsburgh, PA 15261, USA
XX
DR   Ensembl-Gn; ENSGALG00000000544; Gallus_gallus.
DR   Ensembl-Gn; ENSGALG00000001420; Gallus_gallus.
DR   Ensembl-Gn; ENSGALG00000002753; Gallus_gallus.
DR   Ensembl-Gn; ENSGALG00000004357; Gallus_gallus.
DR   Ensembl-Gn; ENSGALG00000004769; Gallus_gallus.
DR   Ensembl-Gn; ENSGALG00000005308; Gallus_gallus.
DR   Ensembl-Gn; ENSGALG00000013678; Gallus_gallus.
DR   Ensembl-Gn; ENSGALG00000014632; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000002165; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000004347; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000006949; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000006950; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000007605; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000008510; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000022238; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000023584; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000033656; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000035251; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000040599; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000040601; Gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000040610; Gallus_gallus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1511
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /sex="male; female"
FT                   /tissue_type="liver"
FT                   /note="derived from dbEST BG712009"
FT                   /db_xref="taxon:9031"
FT   CDS             112..1134
FT                   /codon_start=1
FT                   /product="putative agmatinase"
FT                   /note="agmatine ureohydrolase"
FT                   /db_xref="GOA:Q90XD2"
FT                   /db_xref="InterPro:IPR005924"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q90XD2"
FT                   /protein_id="AAK97629.1"
FT                   /translation="MICLLRTARLSARLLFASAAAPCRRASRFNVPPSAEFVARPVGVC
FT                   SMLRLPVQTSAEGLDAAFVGVPLDTGTSNRPGARFGPQQIRAESVMVRRYNASTGAAPF
FT                   DSLLVADVGDVNVNLYNLPDSCRRIRESYQKIVASGCVPLTLGGDHSITYPILQAVAEK
FT                   HGPVGLVHVDAHTDTSDMALGEKIYHGTPFRRCVDEGLLDCSRVVQIGIRGSSYAPNPY
FT                   KYCWDQGFRVVPAEECWMKSLVPLMGEVRQQMGDGPVYISFDIDGLDPAYAPGTGTPEI
FT                   AGLTPMQALEIIRGCKGLNIVGCDLVEVAPIYDVSGNTALLGANLLFEMLCVLPGVKTM
FT                   "
XX
SQ   Sequence 1511 BP; 320 A; 391 C; 469 G; 331 T; 0 other;
     cggacgcgtg ggcggacgcg tgggcggcag ggtgacacag tgagccgcct ggctgtgttc        60
     ccagctgcag ggacggggca ggctttgggg tctcgctgtg tgtgtggcag gatgatttgt       120
     ctgctcagga cagccaggct ctctgctcgg ttgctttttg catccgctgc cgctccgtgc       180
     cgccgtgcct cgcggttcaa cgtgcctccc agtgctgagt tcgtggcccg gcccgtgggg       240
     gtctgctcca tgctgaggct tcctgttcag acttcagcag aggggctgga tgcggctttt       300
     gtcggcgttc cccttgacac gggcacatcc aaccggcctg gagccaggtt cggtccgcag       360
     cagatccgtg ctgagtcagt gatggtgagg aggtacaacg ccagcaccgg ggcagcgccc       420
     tttgactccc tgctggtggc cgatgttgga gatgtaaatg tcaacctcta caacctgccc       480
     gacagctgcc gccgcatccg tgagtcctac cagaagatcg tggcctctgg ctgcgtgcct       540
     ctcactctgg gtggagacca cagcataaca taccccatcc tgcaggcagt ggcagaaaag       600
     catggccctg tggggctggt gcatgtggac gctcacactg acaccagcga catggctctg       660
     ggggagaaga tctaccatgg gaccccattc cggcgctgcg tggatgaagg gctgctggac       720
     tgcagccgtg tggttcagat tggaatccgt ggctcctcct atgcccccaa tccatacaag       780
     tactgctggg accagggatt ccgggtggtt ccagctgagg agtgctggat gaagtccctg       840
     gttccactga tgggagaggt gaggcagcag atgggggatg gcccagtgta catcagcttt       900
     gatatcgatg ggctggaccc cgcctacgcc ccgggaacgg ggacaccaga gattgctggg       960
     ctcacaccca tgcaggcttt ggagattatt cgtggctgca aaggactcaa tatagtggga      1020
     tgtgaccttg tggaggtggc acccatatat gatgtctctg gtaacactgc cctgttaggg      1080
     gccaatctgc tctttgaaat gttgtgtgtc cttcctggag tgaaaacaat gtgagggcag      1140
     ctcctgcctg gcccccaacc ttgcacagca gtgtaccgcc accagcagat gccatcacag      1200
     accttggatg aggttcctga tgccctgctc tcctccaggt gcagtgatcg tgtgctttgc      1260
     agtaaggaat aaatgctgct aggagaggta gtgaagcaca gcagctgggg agagctgggt      1320
     gtcctttggc ccagccgttg gtgttccagg aggggtttgg ttgcccttgg gatgtgtgag      1380
     ttggtgcaga cacggggtct atatttggca catggaaaca caaaagccac ctcatcacac      1440
     attaaaatag tttatttcgg ttgaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1500
     aaaaaaaaaa a                                                           1511
//