![]() |
EBI DbfetchID AF203030; SV 1; linear; genomic DNA; STD; MAM; 242 BP. XX AC AF203030; XX DT 01-MAY-2000 (Rel. 63, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 4) XX DE Bos taurus thymidylate synthase (TS) gene, exon 6 and partial cds. XX KW . XX OS Bos taurus (cattle) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; OC Bovinae; Bos. XX RN [1] RP 1-242 RX DOI; 10.1007/s003350010220 RX PUBMED; 11130975. RA Brouillette J.A., Andrew J.R., Venta P.J.; RT "Estimate of nucleotide diversity in dogs with a pool-and-sequence method"; RL Mamm. Genome 11(12):1079-1086(2000). XX RN [2] RP 1-242 RA Brouillette J.A., Andrew J.R., Venta P.J.; RT ; RL Submitted (09-NOV-1999) to the EMBL/GenBank/DDBJ databases. RL Microbiology, Michigan State University, G368 Veterinary Clinical Center, RL East Lansing, MI 48824, USA XX FH Key Location/Qualifiers FH FT source 1..242 FT /organism="Bos taurus" FT /mol_type="genomic DNA" FT /db_xref="taxon:9913" FT mRNA join(AF203029.1:<1..112,218..>242) FT /gene="TS" FT /product="thymidylate synthase" FT CDS join(AF203029.1:<1..112,218..>242) FT /codon_start=2 FT /gene="TS" FT /product="thymidylate synthase" FT /db_xref="GOA:Q2TA32" FT /db_xref="InterPro:IPR000398" FT /db_xref="UniProtKB/Swiss-Prot:Q2TA32" FT /protein_id="AAF66224.1" FT /translation="LSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITDLKPGDFVHTL FT " FT exon 218..>242 FT /gene="TS" FT /number=6 XX SQ Sequence 242 BP; 58 A; 47 C; 53 G; 84 T; 0 other; ttagatgcgc tctgtgtaaa tgaatgaact gcttgctcac tgacttgcct ggagcagtta 60 atatgacttt ggatcaactt ttctcaaaag caatactggt taaattttct tgtgaagagc 120 tttggaatgt ctgcatgccc acgtgttttt acatgctgtg ttataaagga actcaaacta 180 aagccttgac agtttcgctt tcttctgtgg ggtttagcca ggtgacttcg tgcacactct 240 tg 242 // ![]() |