![]() |
EBI DbfetchID AF125891; SV 1; linear; genomic DNA; STD; PRO; 277 BP. XX AC AF125891; XX DT 11-AUG-1999 (Rel. 60, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Butyrivibrio fibrisolvens strain E14 xylanase (xynJ1) gene, partial cds. XX KW . XX OS Butyrivibrio fibrisolvens OC Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae; OC Butyrivibrio. XX RN [1] RP 1-277 RX PUBMED; 10427063. RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT "Distribution and evolution of the xylanase genes xynA and xynB and their RT homologues in strains of Butyrivibrio fibrisolvens"; RL Appl. Environ. Microbiol. 65(8):3660-3667(1999). XX RN [2] RP 1-277 RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT ; RL Submitted (04-FEB-1999) to the EMBL/GenBank/DDBJ databases. RL Rumen Biotechnology, CSIRO Tropical Agriculture, Private Bag No 3, RL Indooroopilly, QLD 4068, Australia XX FH Key Location/Qualifiers FH FT source 1..277 FT /organism="Butyrivibrio fibrisolvens" FT /strain="E14" FT /mol_type="genomic DNA" FT /db_xref="taxon:831" FT CDS <1..>277 FT /codon_start=2 FT /transl_table=11 FT /gene="xynJ1" FT /product="xylanase" FT /db_xref="GOA:Q9S4N4" FT /db_xref="HSSP:1BG4" FT /db_xref="InterPro:IPR013781" FT /db_xref="UniProtKB/TrEMBL:Q9S4N4" FT /protein_id="AAD48388.1" FT /translation="MYVKTVMNHVYTNQYGSVVYAWDVANEVLHAENSGWEAVYGNNKV FT NASYVKKAFNYAYDTLEYFKLTNSVKLFYNDFNTYMEVNDVIKLVNY" XX SQ Sequence 277 BP; 95 A; 45 C; 55 G; 82 T; 0 other; gatgtacgta aagacagtta tgaaccatgt atacacaaac cagtatggta gcgttgttta 60 cgcatgggat gtagcaaatg aagttcttca cgcagagaat tctggatggg aagcagttta 120 tggaaacaac aaggtaaatg cttcttatgt aaagaaggct ttcaactatg cttacgatac 180 acttgagtat ttcaagctta caaattctgt aaagcttttc tacaacgact tcaacacata 240 catggaagtt aacgatgtaa ttaagcttgt taattac 277 // ![]() |