![]() |
EBI DbfetchID AF125889; SV 1; linear; genomic DNA; STD; PRO; 277 BP. XX AC AF125889; XX DT 11-AUG-1999 (Rel. 60, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Butyrivibrio fibrisolvens strain D1 xylanase (xynK) gene, partial cds. XX KW . XX OS Butyrivibrio fibrisolvens OC Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae; OC Butyrivibrio. XX RN [1] RP 1-277 RX PUBMED; 10427063. RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT "Distribution and evolution of the xylanase genes xynA and xynB and their RT homologues in strains of Butyrivibrio fibrisolvens"; RL Appl. Environ. Microbiol. 65(8):3660-3667(1999). XX RN [2] RP 1-277 RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT ; RL Submitted (04-FEB-1999) to the EMBL/GenBank/DDBJ databases. RL Rumen Biotechnology, CSIRO Tropical Agriculture, Private Bag No 3, RL Indooroopilly, QLD 4068, Australia XX FH Key Location/Qualifiers FH FT source 1..277 FT /organism="Butyrivibrio fibrisolvens" FT /strain="D1" FT /mol_type="genomic DNA" FT /db_xref="taxon:831" FT CDS <1..>277 FT /codon_start=2 FT /transl_table=11 FT /gene="xynK" FT /product="xylanase" FT /db_xref="GOA:Q9S4N6" FT /db_xref="HSSP:1BG4" FT /db_xref="InterPro:IPR013781" FT /db_xref="UniProtKB/TrEMBL:Q9S4N6" FT /protein_id="AAD48386.1" FT /translation="MYVKTVMNHVYTSQYGSVVYAWDVANEILHAQNSGWEAVYGSNKT FT NASYVKKAFNYAYETLEYFKLTDSVKLFYNDYNTYMEVNDVITLVNY" XX SQ Sequence 277 BP; 95 A; 49 C; 53 G; 80 T; 0 other; gatgtacgtt aagactgtta tgaaccatgt atacacaagc cagtacggca gtgttgtata 60 tgcatgggac gttgctaacg agatccttca tgcacagaac tcaggatggg aagctgttta 120 tggaagcaac aagactaacg cttcttatgt aaagaaagca ttcaattatg cttacgagac 180 acttgagtac ttcaaactta cagattcagt aaaacttttc tataacgatt acaatacata 240 catggaagtt aatgatgtaa tcacacttgt taattac 277 // ![]() |