![]() |
EBI DbfetchID AF125885; SV 1; linear; genomic DNA; STD; PRO; 267 BP. XX AC AF125885; XX DT 11-AUG-1999 (Rel. 60, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Butyrivibrio fibrisolvens strain A46 xylanase (xynI3) gene, partial cds. XX KW . XX OS Butyrivibrio fibrisolvens OC Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae; OC Butyrivibrio. XX RN [1] RP 1-267 RX PUBMED; 10427063. RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT "Distribution and evolution of the xylanase genes xynA and xynB and their RT homologues in strains of Butyrivibrio fibrisolvens"; RL Appl. Environ. Microbiol. 65(8):3660-3667(1999). XX RN [2] RP 1-267 RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT ; RL Submitted (04-FEB-1999) to the EMBL/GenBank/DDBJ databases. RL Rumen Biotechnology, CSIRO Tropical Agriculture, Private Bag No 3, RL Indooroopilly, QLD 4068, Australia XX FH Key Location/Qualifiers FH FT source 1..267 FT /organism="Butyrivibrio fibrisolvens" FT /strain="A46" FT /mol_type="genomic DNA" FT /db_xref="taxon:831" FT CDS <1..>267 FT /codon_start=1 FT /transl_table=11 FT /gene="xynI3" FT /product="xylanase" FT /db_xref="GOA:Q9S4N8" FT /db_xref="HSSP:1BG4" FT /db_xref="InterPro:IPR013781" FT /db_xref="UniProtKB/TrEMBL:Q9S4N8" FT /protein_id="AAD48382.1" FT /translation="KTVMNHVYTNQYGSVVYAWDVANEVLHANDSGWEAVYGNNRKNAS FT YVKKAFNYAYDTLEYFKLTNSVKLFYNDYNTYMEVNDVITLVNY" XX SQ Sequence 267 BP; 99 A; 42 C; 49 G; 77 T; 0 other; aaaacagtta tgaaccacgt atacacaaac cagtatggta gtgttgtata tgcatgggat 60 gtagcaaacg aagttttaca tgcaaatgac tcaggctggg aagcagttta tggcaacaac 120 agaaagaatg cttcttatgt aaagaaggca tttaactatg cttacgatac acttgagtac 180 ttcaagctta caaattcagt aaagcttttc tacaatgatt acaacacata tatggaagta 240 aatgatgtaa ttacacttgt taattac 267 // ![]() |