![]() |
EBI DbfetchID AF125883; SV 1; linear; genomic DNA; STD; PRO; 375 BP. XX AC AF125883; XX DT 11-AUG-1999 (Rel. 60, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Butyrivibrio fibrisolvens strain A38 xylanase (xynZ) gene, partial cds. XX KW . XX OS Butyrivibrio fibrisolvens OC Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae; OC Butyrivibrio. XX RN [1] RP 1-375 RX PUBMED; 10427063. RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT "Distribution and evolution of the xylanase genes xynA and xynB and their RT homologues in strains of Butyrivibrio fibrisolvens"; RL Appl. Environ. Microbiol. 65(8):3660-3667(1999). XX RN [2] RP 1-375 RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT ; RL Submitted (04-FEB-1999) to the EMBL/GenBank/DDBJ databases. RL Rumen Biotechnology, CSIRO Tropical Agriculture, Private Bag No 3, RL Indooroopilly, QLD 4068, Australia XX FH Key Location/Qualifiers FH FT source 1..375 FT /organism="Butyrivibrio fibrisolvens" FT /strain="A38" FT /mol_type="genomic DNA" FT /db_xref="taxon:831" FT CDS <1..>375 FT /codon_start=1 FT /transl_table=11 FT /gene="xynZ" FT /product="xylanase" FT /db_xref="GOA:Q9S4P0" FT /db_xref="HSSP:1BG4" FT /db_xref="InterPro:IPR013781" FT /db_xref="UniProtKB/TrEMBL:Q9S4P0" FT /protein_id="AAD48380.1" FT /translation="HNQTPKWFFCENYNEMFPFADRETILSRLENYIHGVLDFVQNNYP FT GIVYAWDVFNEIVDEGDFRKSLWLRTVGEDFFIKAFEYARKYAAPGVDLFYNDYETSEP FT WKRDFIIEKVLTPLKGKGFVD" XX SQ Sequence 375 BP; 107 A; 73 C; 86 G; 109 T; 0 other; cacaaccaga ctccgaagtg gtttttctgc gagaactaca atgagatgtt cccttttgca 60 gaccgggaga ctatcctttc aagacttgag aactacattc acggagttct tgatttcgta 120 cagaataatt accccggaat agtatatgcc tgggatgttt tcaatgagat tgtggatgag 180 ggcgatttca ggaaatccct gtggcttagg actgtgggcg aagacttttt tatcaaagcc 240 tttgaatatg ccagaaaata tgcagctccc ggagtggatc ttttttacaa tgactacgag 300 acttcggagc cttggaaaag agacttcatc attgaaaaag ttcttacacc tcttaaagga 360 aaaggctttg ttgac 375 // ![]() |