![]() |
EBI DbfetchID AF125882; SV 1; linear; genomic DNA; STD; PRO; 270 BP. XX AC AF125882; XX DT 11-AUG-1999 (Rel. 60, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Butyrivibrio fibrisolvens strain A38 xylanase (xynH) gene, partial cds. XX KW . XX OS Butyrivibrio fibrisolvens OC Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae; OC Butyrivibrio. XX RN [1] RP 1-270 RX PUBMED; 10427063. RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT "Distribution and evolution of the xylanase genes xynA and xynB and their RT homologues in strains of Butyrivibrio fibrisolvens"; RL Appl. Environ. Microbiol. 65(8):3660-3667(1999). XX RN [2] RP 1-270 RA Dalrymple B.P., Swadling Y., Layton I., Gobius K.S., Xue G.P.; RT ; RL Submitted (04-FEB-1999) to the EMBL/GenBank/DDBJ databases. RL Rumen Biotechnology, CSIRO Tropical Agriculture, Private Bag No 3, RL Indooroopilly, QLD 4068, Australia XX DR StrainInfo; 105039; A 38. XX FH Key Location/Qualifiers FH FT source 1..270 FT /organism="Butyrivibrio fibrisolvens" FT /strain="A38" FT /mol_type="genomic DNA" FT /db_xref="taxon:831" FT CDS <1..>270 FT /codon_start=2 FT /transl_table=11 FT /gene="xynH" FT /product="xylanase" FT /db_xref="GOA:Q9S4P1" FT /db_xref="HSSP:1HIZ" FT /db_xref="InterPro:IPR001000" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR017853" FT /db_xref="UniProtKB/TrEMBL:Q9S4P1" FT /protein_id="AAD48379.1" FT /translation="MYVKTVMNHVYNSQYGSVVYAWDVCNEILHAQNSGWEAVYGSNKT FT NASYVKKAFNYAYETLEYFKLTDSVKLFYNDYNTYMEVNNVITLV" XX SQ Sequence 270 BP; 85 A; 59 C; 54 G; 72 T; 0 other; gatgtatgtt aagaccgtca tgaaccacgt atacaacagc cagtacggct cagttgttta 60 tgcatgggac gtttgcaacg agatccttca cgctcagaac tccggttggg aagcagttta 120 cggcagcaac aagaccaacg cttcttatgt aaagaaggca tttaactacg catatgagac 180 tcttgagtac ttcaagctca cagattcagt taagcttttt tacaatgatt acaacacata 240 catggaagtt aacaacgtaa tcacacttgt 270 // ![]() |