![]() |
EBI DbfetchID AF069648; SV 1; linear; mRNA; STD; MAM; 336 BP. XX AC AF069648; XX DT 17-JUN-1998 (Rel. 56, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 3) XX DE Sus scrofa TNF-alpha converting enzyme mRNA, partial cds. XX KW . XX OS Sus scrofa (pig) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus. XX RN [1] RP 1-336 RX DOI; 10.1016/S0945-053X(99)00024-4 RX PUBMED; 10429942. RA Flannery C.R., Little C.B., Caterson B., Hughes C.E.; RT "Effects of culture conditions and exposure to catabolic stimulators (IL-1 RT and retinoic acid) on the expression of matrix metalloproteinases (MMPs) RT and disintegrin metalloproteinases (ADAMs) by articular cartilage RT chondrocytes"; RL Matrix Biol. 18(3):225-237(1999). XX RN [2] RP 1-336 RA Flannery C.R.; RT ; RL Submitted (03-JUN-1998) to the EMBL/GenBank/DDBJ databases. RL Connective Tissue Biology Laboratories, Cardiff University, Museum Avenue, RL Cardiff CF1 3US, UK XX FH Key Location/Qualifiers FH FT source 1..336 FT /organism="Sus scrofa" FT /mol_type="mRNA" FT /cell_type="articular cartilage chondrocyte" FT /db_xref="taxon:9823" FT CDS <1..>336 FT /codon_start=1 FT /product="TNF-alpha converting enzyme" FT /note="metalloproteinase disintegrin; TACE; similar to Homo FT sapiens TNF-alpha converting enzyme encoded by GenBank FT Accession Number U69611" FT /db_xref="GOA:O77636" FT /db_xref="InterPro:IPR001590" FT /db_xref="UniProtKB/Swiss-Prot:O77636" FT /protein_id="AAC23532.1" FT /translation="MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS FT HGGVCPKAYYSPIGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDG FT LAECAPNE" XX SQ Sequence 336 BP; 107 A; 60 C; 74 G; 95 T; 0 other; atgttgcgag agcaatttag ctttgatata gctgaagaag catctaaagt ctgcctggca 60 catcttttca cctaccaaga ttttgatatg ggaactcttg gattagctta tgttggttct 120 cccagagcaa acagtcatgg aggtgtttgt ccaaaggctt attatagtcc aattggaaag 180 aaaaatatct atttaaatag tggtttgacc agcacaaaaa attatggtaa aaccatcctt 240 acaaaggaag ctgaccttgt gacaactcat gaattggggc acaattttgg agcagaacac 300 gatccagatg gtttagcaga atgtgccccg aatgag 336 // ![]() |