![]() |
EBI DbfetchID AF068256; SV 1; linear; genomic DNA; STD; PRO; 221 BP. XX AC AF068256; XX DT 23-DEC-1998 (Rel. 58, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 3) XX DE Thermococcus hydrothermalis strain AL662 alpha-amylase (amy) gene, partial DE cds. XX KW . XX OS Thermococcus hydrothermalis OC Archaea; Euryarchaeota; Thermococci; Thermococcales; Thermococcaceae; OC Thermococcus. XX RN [1] RP 1-221 RA Leveque E., Belarbi A., Haye B.; RT ; RL Unpublished. XX RN [2] RP 1-221 RX PUBMED; 10779714. RA Leveque E., Haye B., Belarbi A.; RT "Cloning and expression of an alpha-amylase encoding gene from the RT hyperthermophilic archaebacterium Thermococcus hydrothermalis and RT biochemical characterisation of the recombinant enzyme"; RL FEMS Microbiol. Lett. 186(1):67-71(2000). XX RN [3] RP 1-221 RA Leveque E., Haye B., Belarbi A.; RT ; RL Submitted (24-MAY-1998) to the EMBL/GenBank/DDBJ databases. RL Laboratory of General and Molecular Microbiology, UFR Sciences, University RL of Reims-Champagne-Ardenne, Moulin de la Housse, BP 1039, Reims Cedex 2 RL 51687, France XX FH Key Location/Qualifiers FH FT source 1..221 FT /organism="Thermococcus hydrothermalis" FT /strain="AL662" FT /mol_type="genomic DNA" FT /note="amplified via PCR" FT /db_xref="taxon:46539" FT CDS <1..>221 FT /codon_start=3 FT /transl_table=11 FT /gene="amy" FT /product="alpha-amylase" FT /db_xref="GOA:O93648" FT /db_xref="HSSP:1MXG" FT /db_xref="InterPro:IPR006047" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR017853" FT /db_xref="UniProtKB/TrEMBL:O93648" FT /protein_id="AAC97878.1" FT /translation="WAAVREYWDTNVDALLSWAYDSGAKVFDFPLYYKMDEAFDNNNIP FT ALVDALKNGGTVVSRDPFKAVTFVANHD" XX SQ Sequence 221 BP; 50 A; 73 C; 60 G; 38 T; 0 other; gatgggcggc ggttcgagag tactgggaca ccaacgtcga tgcactcctg agctgggcct 60 acgacagcgg tgctaaagtc ttcgacttcc cgctctacta caagatggac gaggccttcg 120 ataacaacaa catccccgcc ctcgtggacg ccctcaagaa cggaggcacg gtcgtcagcc 180 gcgacccgtt caaagccgtg accttcgtcg ccaaccacga t 221 // ![]() |