 |
|
EBI DbfetchID AF039752; SV 1; linear; mRNA; STD; VRT; 1878 BP. XX AC AF039752; XX DT 20-JAN-1998 (Rel. 54, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 3) XX DE Gallus gallus histone deacetylase-2 mRNA, complete cds. XX KW . XX OS Gallus gallus (chicken) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; OC Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. XX RN [1] RP 1-1878 RX DOI; 10.1074/jbc.274.34.23977 RX PUBMED; 10446166. RA Takami Y., Kikuchi H., Nakayama T.; RT "Chicken histone deacetylase-2 controls the amount of the IgM H-chain at RT the steps of both transcription of its gene and alternative processing of RT its pre-mRNA in the DT40 cell line"; RL J. Biol. Chem. 274(34):23977-23990(1999). XX RN [2] RP 1-1878 RA Takami Y.; RT ; RL Submitted (23-DEC-1997) to the EMBL/GenBank/DDBJ databases. RL Biochemistry, Miyazaki Medical Collage, Kiyotake Kihara 5200, Miyazaki RL 889-16, Japan XX DR Ensembl-Gn; ENSGALG00000002461; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000004183; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000004719; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006705; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006786; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006793; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000007082; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000007516; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000008000; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000008455; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000008537; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000009107; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000009598; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000010031; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000010053; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000014960; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000014991; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000021016; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000021316; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000003883; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000005597; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000006649; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000006668; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000006672; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000007516; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000010976; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000010984; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000010985; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000011472; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000012154; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000013011; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000013777; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000013912; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000014832; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000015639; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000016293; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000016337; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000024127; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000024179; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000038555; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039756; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039784; Gallus_gallus. XX FH Key Location/Qualifiers FH FT source 1..1878 FT /organism="Gallus gallus" FT /mol_type="mRNA" FT /cell_line="DT40" FT /db_xref="taxon:9031" FT CDS 71..1537 FT /codon_start=1 FT /product="histone deacetylase-2" FT /note="HD-2" FT /db_xref="GOA:P56519" FT /db_xref="InterPro:IPR000286" FT /db_xref="InterPro:IPR003084" FT /db_xref="UniProtKB/Swiss-Prot:P56519" FT /protein_id="AAB96924.1" FT /translation="MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLN FT YGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVF FT DGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILE FT LLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSEVSMVNNFPGTGDLRDIGAGKGKY FT YAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKG FT HAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGP FT DFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDG FT EDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKK FT ADVKEEDKSKDNSGEKTDTKGAKSEQLSNP" XX SQ Sequence 1878 BP; 590 A; 333 C; 440 G; 515 T; 0 other; ggctcgatct cgcctcggcc tcccgttccc tcctccccct gccccgactc gtccccggcg 60 cggcggccct atggcgtaca gtcagggcgg cggcaagaag aaagtctgct actactacga 120 tggtgatatt ggaaactatt actatggaca agggcatcca atgaaacctc ataggatccg 180 aatgactcac aacttgctcc taaattatgg cttgtacagg aaaatggaaa tttaccgacc 240 ccacaaagct actgctgagg aaatgaccaa gtaccatagt gatgaataca tcaaatttct 300 cagatcaata aggcctgaca atatgtctga gtacagcaag cagatgcaaa gatttaatgt 360 tggagaagat tgtcctgtat ttgatggcct gtttgagttt tgtcagctgt caactggagg 420 ctctgttgct ggggcggtaa aattgaacag acagcagaca gacatggctg ttaattgggc 480 tggaggactt caccatgcca agaagtcaga ggcatctggt ttttgttatg tcaatgatat 540 tgtgcttgcc atccttgagt tactgaagta tcaccaaaga gtgttgtata ttgatattga 600 tatccatcat ggtgatggtg ttgaagaagc attttatacc acagatcgtg tcatgactgt 660 gtcagaggta agtatggtga ataattttcc aggcacaggg gaccttaggg acattggtgc 720 tggaaaaggc aaatactatg ctgtcaactt tccaatgagg gatggtatag atgatgagtc 780 gtatggacag atattcaaac caattatatc aaaagtaatg gagatgtacc agcccagtgc 840 tgtagtatta cagtgtggag cagattcatt gtctggtgat aggttgggat gctttaatct 900 tactgttaaa ggtcatgcaa aatgtgtgga agttgtaaag accttcaact tgccattgct 960 gatgttagga ggaggtggat atactattcg caatgttgct cgatgctgga catatgaaac 1020 tgctgttgcc ttagattgtg aaattcctaa tgaattacca tacaatgatt actttgagta 1080 ttttggacca gacttcaaac ttcatattag tccatcaaat atgactaatc agaatacacc 1140 agaatatatg gaaaagatca agcaacgctt atttgaaaac ttgcgcatgt tacctcatgc 1200 acctggtgta cagatgcagg ccattcctga agatgctgtt catgaagata gtggagatga 1260 ggatggagaa gatccagaca aacgcatttc tattcgagca tctgataagc gcattgcctg 1320 tgatgaggag ttttcagact ctgaagatga aggggaaggt ggacggcgaa atgttgcaga 1380 tcacaagaaa ggagcaaaga aagctaggat agaggaagac aagaaagaga cagaggacaa 1440 aaaagcagat gttaaggagg aggataaatc caaggacaac agtggtgaaa agacggacac 1500 caaaggagca aaatcagaac agctcagcaa tccttgaaca aaagatagcc tcacatcaat 1560 tgcagaacat aatgctagaa ttggagaata cctaaaggaa gaagttttca tattgagaaa 1620 gactgctgat ttcatttttg tactatttgg catggaccgt atcattttca aacggctttg 1680 ttctggtttt ggcaagttgt attgtgagtt tctaatcatg aggcagaaat tcccttcttc 1740 accatgcttt atgtaatagt atttaaaatg gatgtgagtt atgttaaatg tccaaaccga 1800 tccattaaag taaattgcct ttcctgagct gatttacctt tttgtaattt tatctttatt 1860 aaaaaaaaaa aaaaaaaa 1878 // |
|