 |
|
EBI DbfetchID AF017119; SV 1; linear; genomic DNA; STD; PRO; 1660 BP. XX AC AF017119; XX DT 20-DEC-1997 (Rel. 54, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 3) XX DE Chromatium vinosum MoxR homolog gene, partial cds; sulfur globule protein DE Cv1 precursor (sgp1) gene, complete cds; and biotin carboxylase homolog DE gene, partial cds. XX KW . XX OS Allochromatium vinosum OC Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; OC Allochromatium. XX RN [1] RP 1-1660 RX DOI; 10.1007/BF00272127 RX PUBMED; 7575095. RA Brune D.C.; RT "Isolation and characterization of sulfur globule proteins from Chromatium RT vinosum and Thiocapsa roseopersicina"; RL Arch. Microbiol. 163(6):391-399(1995). XX RN [2] RP 1-1660 RX DOI; 10.1007/s002030050594 RX PUBMED; 9560425. RA Pattaragulwanit K., Brune D.C., Truper H.G., Dahl C.; RT "Molecular genetic evidence for extracytoplasmic localization of sulfur RT globules in Chromatium vinosum"; RL Arch. Microbiol. 169(5):434-444(1998). XX RN [3] RP 1-1660 RA Pattaragulwanit K., Brune D.C., Trueper H.G., Dahl C.; RT ; RL Submitted (05-AUG-1997) to the EMBL/GenBank/DDBJ databases. RL Institut fuer Mikrobiologie & Biotechnologie, Universitaet Bonn, RL Meckenheimer Allee 168, D-53115 Bonn, Germany XX FH Key Location/Qualifiers FH FT source 1..1660 FT /organism="Allochromatium vinosum" FT /strain="D (DSMZ 180)" FT /mol_type="genomic DNA" FT /db_xref="taxon:1049" FT CDS complement(<1..574) FT /codon_start=1 FT /transl_table=11 FT /product="MoxR homolog" FT /note="similar to products encoded by GenBank Accession FT Numbers X96434 and U17109" FT /db_xref="GOA:O52056" FT /db_xref="InterPro:IPR011703" FT /db_xref="UniProtKB/TrEMBL:O52056" FT /protein_id="AAB91544.1" FT /translation="MEQSPNLDLNKGADAQAYSTAALAQRFAALRDQVGRAILGQHGLI FT ERLLIALLADGHLLVEGAPGLAKTTAVKHLAAGLEGDFHRIQFTPDLLPADLTGTEIYR FT PHDGSFRFDRGPIFHNLLLADEVNRAPAKVQSALLEAMGERQVTVGRETYPLPELFLVM FT ATQNPIEQEGTYPLPEAQLDRFLLHVRV" FT RBS complement(580..585) FT RBS 721..724 FT CDS 733..1116 FT /codon_start=1 FT /transl_table=11 FT /gene="sgp1" FT /product="sulfur globule protein Cv1 precursor" FT /note="similar to Chromatium vinosum sulfur globule protein FT Cv2 and Thiocapsa roseopersicina sulfur globule protein FT Tr0; together with the structural proteins Cv2 and Cv3, Cv1 FT constitutes the protein envelope of the intracellular FT sulfur globules of Chromatium vinosum; the protein is FT extremely hydrophobic" FT /db_xref="UniProtKB/Swiss-Prot:O52057" FT /protein_id="AAB91543.1" FT /translation="MIKSNRITACALAALFAGASFSASAWWGGPGYGNGLWDNMGDMFG FT DGYGDFNMSMGGGGRGYGRGYGRGNGYGYGAPYGYGAPYGYGAPYGYGAPYGYGAPYGA FT MPYGAMPPQMPAAPAQPQAAPSR" FT sig_peptide 733..807 FT /gene="sgp1" FT /note="signal peptide for periplasmic localization of the FT mature protein." FT mat_peptide 808..1113 FT /gene="sgp1" FT /product="sulfur globule protein Cv1" FT stem_loop 1166..1199 FT CDS complement(1238..>1660) FT /codon_start=1 FT /transl_table=11 FT /product="biotin carboxylase homolog" FT /EC_number="6.3.4.14" FT /note="similar to E. coli biotin carboxylase: SwissProt FT Accession Number P24182" FT /db_xref="GOA:O52058" FT /db_xref="HSSP:1DV1" FT /db_xref="InterPro:IPR005479" FT /db_xref="UniProtKB/Swiss-Prot:O52058" FT /protein_id="AAB91545.1" FT /translation="VDIVKEQILIAAGEPLRYRQSDIQMRGHAIECRINAEHPETFMPS FT PGKITDFHAPGGPGVRIETHIYSGYTVPCHYDSMIGKLITHGEDRESAVARMCNALRET FT VIEGIHSNIKLQRSLMRDGAFLAGANIHYLEKMLGL" XX SQ Sequence 1660 BP; 274 A; 521 C; 546 G; 319 T; 0 other; cgacgcgcac atgcagcagg aagcgatcga gctgagcctc gggcaacgga taggtgccct 60 cctgctcgat cgggttctgg gtcgccatga ccagaaagag ttcgggcagc ggataggtct 120 cgcgtccgac cgtgacctga cgctcgccca tggcctccag cagcgccgac tgcaccttgg 180 ccggggcgcg gttgacttcg tcagccagca gcagattgtg gaagatggga ccgcgatcga 240 agcggaaact gccgtcgtgc gggcgataga tctcggtgcc ggtcagatcg gccggcagca 300 ggtcgggggt gaactggata cggtggaagt cgccctccag accggcggcc aggtgcttga 360 cggctgtggt cttggccagc cctggagccc cctcgaccag cagatgcccg tcggccagca 420 gcgcgatcag cagccgctca atcaggccgt gctgcccgag gatggcgcgc ccgacctgat 480 cgcgcagtgc cgcgaaacgc tgggctagag ctgctgtgct gtacgcttgg gcgtccgcgc 540 ccttgttcaa gtccaggttg gggctctgtt ccaaggctcg cctcctcgca aagatctcag 600 ccgatcgatg cctataggtt tgcaggtttc gccggtcgat gccgttaaaa ttttttcagg 660 tgcattgtgg atgcctaccc cggcccctat actggctcag ccattccggc tccacaactt 720 gaggaagaca caatgatcaa atccaaccgg atcaccgctt gcgctctcgc cgcgctcttc 780 gccggcgcct cattctccgc aagcgcctgg tggggtggtc ccggctacgg caacggcctc 840 tgggacaaca tgggtgacat gttcggcgat ggctatggcg acttcaatat gagcatgggc 900 ggcggcggtc gcggttacgg ccgtggttat ggtcgcggca atggctatgg ttacggcgcg 960 ccctacggct atggtgcgcc ctatggttat ggcgccccct acggctacgg cgctccctat 1020 ggttacggcg caccttacgg cgccatgccc tatggcgcga tgccgcccca gatgccggcc 1080 gctcctgccc agccacaggc cgctccgagc cgttgaggct cgatccgccc agggtgatcg 1140 gccgcgcgcg ctggcggcca cactgaaaac gcctcgctct tccgagtcga ggcgtttttg 1200 cgtttgaggc gtgccgataa cggcaaagac ctcgccgcta gaggccgagc atcttctcca 1260 gatagtggat attggcgccg gccaggaagg ccccatcgcg catgagcgag cgctggagct 1320 tgatgttgga gtggatgccc tcgatgaccg tctcacgcag ggcattgcac atgcgtgcca 1380 ccgccgactc gcggtcctcg ccgtgggtga tgagcttgcc gatcatcgag tcatagtgac 1440 agggcacggt atagcccgag tagatatggg tctcgatccg cactccaggc ccgcccggcg 1500 cgtggaagtc ggtgatcttg cccggactgg gcatgaaggt ctcgggatgc tcggcgttga 1560 tgcggcactc gatggcatgt ccgcgcatct ggatgtccga ctggcggtag cgcagcggct 1620 cgccggcggc gatcaagatc tgctccttga cgatgtcgac 1660 // |
|