spacer
spacer

EBI Dbfetch

ID   AB169261; SV 1; linear; mRNA; STD; MAM; 1239 BP.
XX
AC   AB169261;
XX
DT   20-JUN-2005 (Rel. 84, Created)
DT   06-OCT-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Macaca fascicularis testis cDNA, clone: QtsA-18326, similar to human
DE   aspartylglucosaminidase (AGA), mRNA, RefSeq: NM_000027.2.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Macaca fascicularis (crab-eating macaque)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini;
OC   Cercopithecidae; Cercopithecinae; Macaca.
XX
RN   [1]
RP   1-1239
RA   Hashimoto K., Kusuda J., Sugano S.;
RT   ;
RL   Submitted (18-MAR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Katsuyuki Hashimoto, National Institute of Infectious Diseases, Division of
RL   Genetic Resources; 23-1, Toyama 1-chome, Shinjuku-ku, Tokyo 162-8640, Japan
RL   (E-mail:khashi@nih.go.jp, URL:http://www.nih.go.jp/yoken/genebank/,
RL   Tel:81-3-5285-1111(ex.2120), Fax:81-3-5285-1181)
XX
RN   [2]
RG   International consortium for macaque cDNA sequencing and analysis
RA   ;
RT   "DNA sequences of macaque genes expressed in brain or testis and its
RT   evolutionary implications";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1093/molbev/msi187
RX   PUBMED; 15944441.
RA   Osada N., Hirata M., Tanuma R., Kusuda J., Hida M., Suzuki Y., Sugano S.,
RA   Gojobori T., Shen C.-K.J., Wu C.I., Hashimoto K.;
RT   "Substitution rate and structural divergence of 5'UTR evolution:
RT   comparative analysis between human and cynomolgus monkey cDNAs";
RL   Mol. Biol. Evol. 22(10):1976-1982(2005).
XX
CC   The International consortium for macaque cDNA sequencing
CC   and analysis consists of: Department of Virology and Human
CC   Genome Center, Institute of Medical Science, The University of
CC   Tokyo, Tokyo, Japan; Division of Genetic Resources, National
CC   Institute of Infectious Diseases of Japan, Tokyo, Japan; National
CC   Health Research Institute, Taipei, Taiwan; Institute of Molecular
CC   Biology, Academia Sinica, Taipei, Taiwan; Department of Ecology &
CC   Evolution, University of Chicago, Chicago, IL, USA; Center for
CC   Information Biology, National Institute of Genetics of Japan,
CC   Mishima, Japan.
CC   Clone distribution: clone distribution information can be
CC   found at: http://www.nih.go.jp/yoken/genebank/
CC   Lab host:    TOP10
CC   Vector:      pME18S-FL3 (Acc.No. AB009864)
CC   R.  Site1:   DraIII (CACTGTGTG)
CC   R.  Site2:   DraIII (CACCATGTG)
CC   Description: 1st strand cDNA was primed with an oligo(dT) primer
CC   [ATGTGGCCTTTTTTTTTTTTTTTTT]; double-stranded cDNA was
CC   synthesized using specific 5' and 3' primers and amplified
CC   by PCR.  The PCR product was digested with SfiI and size selection
CC   was performed to exclude fragments <1.5kb.The SfiI-digested
CC   PCR product was cloned into distinct DraIII sites of pME18S-FL3.
CC   XhoI sites just outside the DraIII sites can be used to
CC   isolate the cDNA insert.  Libraries were constructed by
CC   oligo-capping method. Libraries were made from:
CC                QccE: cerebellum cortex
CC                QnpA: parietal lobe
CC                QtrA: temporal lobe right
CC                QflA: frontal lobe left
CC                QmoA: medulla oblongata
CC                QbsA: brain stem
CC                QorA: occipital lobe right
CC                QtsA: testis
CC   Custom primers were used for 5' and 3'-end sequencing. The
CC   full-insert sequencing was done by primer-walking method using ABI
CC   DNA sequencer.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1239
FT                   /organism="Macaca fascicularis"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="macaque cDNA library QtsA"
FT                   /clone="QtsA-18326"
FT                   /db_xref="taxon:9541"
FT   CDS             29..1069
FT                   /note="Homo sapiens aspartylglucosaminidase (AGA), mRNA,
FT                   RefSeq: NM_000027.2"
FT                   /db_xref="GOA:Q4R6C4"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4R6C4"
FT                   /protein_id="BAE01351.1"
FT                   /translation="MARKSKLPLLLVPLLLCQALVRCSSPLPLVLNTWPFKNATEAAWR
FT                   ALASGGSALDAVESGCAMCETEQCGGSVGFGGSPDELGETTLDAMIMEGTTMDVGAVGD
FT                   LRRIKNAIGVARKVLEHTTHTLLVGESATKFAESMGFVNEDLSTSASQALHSDWLARNC
FT                   QPNYWRNVVPDPSKYCGPYKPLGILKQDIPIHKETEDNRGHDTIGMVVIHKTGRIAAGT
FT                   STNGIKFKIHGRVGDSPVPGAGAYADDTAGAAAATGEGDILMRFLPSYQAVEYMRGGED
FT                   PTIACQKVISRIQKYFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTE
FT                   EKVDCI"
XX
SQ   Sequence 1239 BP; 365 A; 261 C; 295 G; 318 T; 0 other;
     ctcgcgctag tgccctcggc gctcagctat ggcgcggaag tcgaaattgc ctctgcttct        60
     cgtgccgctt ctgctctgcc aggccctagt gcgctgctcc agccctctgc ccctggtcct       120
     caacacttgg ccttttaaga atgcaaccga agcagcgtgg agggcgttag catctggagg       180
     ctctgccctg gatgcggtgg agagcggctg tgccatgtgt gagacagagc agtgtggcgg       240
     ctctgtaggc tttggaggaa gtcctgatga acttggagaa accacattag atgccatgat       300
     catggagggc actactatgg atgtaggagc agtaggagat cttagacgaa ttaaaaatgc       360
     tattggtgtg gcacggaaag tactggaaca tacaacacac acacttttag taggagagtc       420
     agccaccaaa tttgccgaaa gtatggggtt tgtcaatgaa gatttatcta ccagtgcttc       480
     tcaagctctt cattcagatt ggcttgctcg gaattgccag ccaaattatt ggaggaatgt       540
     tgtacctgat ccctcaaaat actgcggacc ctacaaacca cttggtatct taaagcagga       600
     tattcctatc cataaagaaa cagaagataa tcgtggtcat gacactattg gcatggttgt       660
     aatccataag acaggacgta tcgctgctgg tacatctaca aatggtataa aattcaaaat       720
     acatggccgt gtaggagact caccagtacc tggagctgga gcctatgctg acgatactgc       780
     aggggccgcc gccgccactg gggaaggcga tatattgatg cgcttcctac caagctacca       840
     agctgtagaa tacatgagag gaggagaaga tccaaccata gcttgccaaa aagtgatttc       900
     aagaatccag aagtattttc cagaattctt tggggctgtt atatgtgcca atgtgactgg       960
     aagttatggt gctgcttgta ataaactttc aacatttact cagtttagtt tcatggttta      1020
     taattctgaa aaaaatcagc caactgagga aaaagtggac tgcatctagt ccatcttttc      1080
     tgtcagcatc tgtatttaaa gaagaaagaa acaaaggctg aacaggctgc tcactagcat      1140
     catctagtgt tcctcatgtg ttctaaagtc tttttgtaaa ataaacacaa aaataaattt      1200
     ctgttgatgt ggcaaaaaaa aaaaaaaaaa aaaaaaaaa                             1239
//


  
spacer
spacer