spacer
spacer

EBI Dbfetch

ID   AB168713; SV 1; linear; mRNA; STD; MAM; 1993 BP.
XX
AC   AB168713;
XX
DT   20-JUN-2005 (Rel. 84, Created)
DT   06-OCT-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Macaca fascicularis testis cDNA clone: QtsA-14329, similar to human
DE   asparaginase like 1 (ASRGL1), mRNA, RefSeq: NM_025080.2.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Macaca fascicularis (crab-eating macaque)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini;
OC   Cercopithecidae; Cercopithecinae; Macaca.
XX
RN   [1]
RP   1-1993
RA   Hashimoto K., Kusuda J., Sugano S.;
RT   ;
RL   Submitted (18-MAR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Katsuyuki Hashimoto, National Institute of Infectious Diseases, Division of
RL   Genetic Resources; 23-1, Toyama 1-chome, Shinjuku-ku, Tokyo 162-8640, Japan
RL   (E-mail:khashi@nih.go.jp, URL:http://www.nih.go.jp/yoken/genebank/,
RL   Tel:81-3-5285-1111(ex.2120), Fax:81-3-5285-1181)
XX
RN   [2]
RG   International consortium for macaque cDNA sequencing and analysis
RA   ;
RT   "DNA sequences of macaque genes expressed in brain or testis and its
RT   evolutionary implications";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1093/molbev/msi187
RX   PUBMED; 15944441.
RA   Osada N., Hirata M., Tanuma R., Kusuda J., Hida M., Suzuki Y., Sugano S.,
RA   Gojobori T., Shen C.-K.J., Wu C.I., Hashimoto K.;
RT   "Substitution rate and structural divergence of 5'UTR evolution:
RT   comparative analysis between human and cynomolgus monkey cDNAs";
RL   Mol. Biol. Evol. 22(10):1976-1982(2005).
XX
CC   The International consortium for macaque cDNA sequencing
CC   and analysis consists of: Department of Virology and Human
CC   Genome Center, Institute of Medical Science, The University of
CC   Tokyo, Tokyo, Japan; Division of Genetic Resources, National
CC   Institute of Infectious Diseases of Japan, Tokyo, Japan; National
CC   Health Research Institute, Taipei, Taiwan; Institute of Molecular
CC   Biology, Academia Sinica, Taipei, Taiwan; Department of Ecology &
CC   Evolution, University of Chicago, Chicago, IL, USA; Center for
CC   Information Biology, National Institute of Genetics of Japan,
CC   Mishima, Japan.
CC   Clone distribution: clone distribution information can be
CC   found at: http://www.nih.go.jp/yoken/genebank/
CC   Lab host:    TOP10
CC   Vector:      pME18S-FL3 (Acc.No. AB009864)
CC   R.  Site1:   DraIII (CACTGTGTG)
CC   R.  Site2:   DraIII (CACCATGTG)
CC   Description: 1st strand cDNA was primed with an oligo(dT) primer
CC   [ATGTGGCCTTTTTTTTTTTTTTTTT]; double-stranded cDNA was
CC   synthesized using specific 5' and 3' primers and amplified
CC   by PCR.  The PCR product was digested with SfiI and size selection
CC   was performed to exclude fragments <1.5kb.The SfiI-digested
CC   PCR product was cloned into distinct DraIII sites of pME18S-FL3.
CC   XhoI sites just outside the DraIII sites can be used to
CC   isolate the cDNA insert.  Libraries were constructed by
CC   oligo-capping method. Libraries were made from:
CC                QccE: cerebellum cortex
CC                QnpA: parietal lobe
CC                QtrA: temporal lobe right
CC                QflA: frontal lobe left
CC                QmoA: medulla oblongata
CC                QbsA: brain stem
CC                QorA: occipital lobe right
CC                QtsA: testis
CC   Custom primers were used for 5' and 3'-end sequencing. The
CC   full-insert sequencing was done by primer-walking method using ABI
CC   DNA sequencer.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1993
FT                   /organism="Macaca fascicularis"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="macaque cDNA library QtsA"
FT                   /clone="QtsA-14329"
FT                   /db_xref="taxon:9541"
FT   CDS             111..1037
FT                   /note="Homo sapiens asparaginase like 1 (ASRGL1), mRNA,
FT                   RefSeq: NM_025080.2"
FT                   /db_xref="GOA:Q4R7U8"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4R7U8"
FT                   /protein_id="BAE00824.1"
FT                   /translation="MNPIVVVHGGGAGPISKDRKERMHQGIVRAATVGYGILREGGSAV
FT                   DAVEGAVVALEDDPEFNAGCGSVLNTDGEVEMDASIMDGKDLSVGAVSAVRCIANPIKL
FT                   ARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTEKNKKRLEKEKHEKGAQKTDCE
FT                   KNLGTVGAVALDFKGNVAYATSTGGIVNKMVGRVGDTPCVGAGGYADNDIGAISTTGHG
FT                   ESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTST
FT                   SMPWAAAKDGKLHFGIDPDDTAITDLP"
XX
SQ   Sequence 1993 BP; 508 A; 466 C; 566 G; 453 T; 0 other;
     gggtttcaag ccggcgtcag ggagcggcgg tactgggcga ttgctggggc ggctcgaccc        60
     agcctgaggc ctcggcgtcc gcctcccgcg gtgcgctggg atccgccgac atgaatccca       120
     tcgtagtggt ccacggcggc ggagccggtc ccatctccaa ggatcggaag gagcgaatgc       180
     accagggcat cgtcagagcc gccaccgtgg gctacggcat cctccgggag ggcgggagcg       240
     cagtggatgc cgtggaggga gctgtggtcg ccctggaaga cgatcccgag ttcaacgcag       300
     gttgtgggtc tgtcttgaac acagatggtg aggttgaaat ggatgctagt atcatggatg       360
     ggaaagacct gtcagtagga gcagtgtccg cagtccggtg tatagcaaat cccattaaac       420
     ttgctcggct tgtcatggaa aagacacctc attgctttct cactgaccaa ggtgcagcac       480
     agtttgcagc agctatgggg gttccagaga ttcctggaga aaaactggta acagagaaaa       540
     acaaaaagcg cctggaaaaa gagaagcacg aaaaaggtgc tcagaaaaca gattgtgaaa       600
     aaaacctggg aaccgtgggt gctgttgcct tggacttcaa agggaatgta gcctacgcaa       660
     cctccacagg gggtatcgtt aataaaatgg tcggccgagt tggggacaca ccgtgtgtag       720
     gagctggagg ttatgctgac aatgacatcg gagccatctc aaccacaggg catggggaaa       780
     gcatcctgaa ggtgaacctg gccagactca ccctgttcca catagaacaa ggaaagacgg       840
     tagaagaggc tgcggaccta tcgttgggtt atatgaagtc aagggttaaa ggtttaggtg       900
     gccttatcgt ggttagcaaa acaggagact gggtggcaaa gtggacctcc acctccatgc       960
     cctgggcagc cgccaaggac ggcaagctgc acttcggaat tgatcctgac gatactgcta      1020
     tcacggacct gccctaagcc cctggaagat tgtattccag atgctagctg agaggtcaag      1080
     tacggtctcc tcatgagacg tagcctaatc aattagatct agaattggaa aaattgtccc      1140
     gtctgtcact tgttttgttg ccttaataag catctgaatg tttggttgag gggcgggttc      1200
     tgaagcgatg agagaaatgc ctgttttagg aggattgctc gagcctggga ggtcaaagct      1260
     gaggcgtttg aaagtgagac agcagcagca gaggcactgg tgggccaagt ccaggtgacc      1320
     ctcagaatgt tgcacaagag catcggggga aagaaccaga atcctttaag ggaaatgttc      1380
     ttcatgtaca agagagtaaa gagatttttc taagaaggtt cagctcttct ctgacttacc      1440
     tggacatttc tagatacttc caaaggaccc tgtgggaacc catagctccc taacctgaag      1500
     atgggaggtc gtaatggaga tgctgtggga tttcttgaag tttcttgggt tcacagagaa      1560
     gccccctcac ttgttgttct cccgcgagcc agcctccacc tgccaaagac actctggtcc      1620
     tcgtatagtg agtagtgggg ctcacggcct ctccaacaac agagaggagc tgactgctgt      1680
     agagctggcc ccatgacttc ctgagtcctc accctgtcca gtgctttgag attcttccca      1740
     cctccccatc tccccagctg gatcgggcgc tgtgcagtgt ggtcagcgtg gtgaagaaag      1800
     tcatttcttt ggtggacaat attccccttt atctctcatt acactggaaa tgttacttct      1860
     gctgtatcgt ccgtgctcaa ggttttagtc tgtcagggct caccttctcg ctggaaagaa      1920
     tttgcttaac ttgacattcc atgtgccgct aataaaatct attttgaaag aaaaaaaaaa      1980
     aaaaaaaaaa aaa                                                         1993
//


  
spacer
spacer