![]() |
EBI DbfetchID AB028011; SV 1; linear; genomic DNA; STD; FUN; 604 BP. XX AC AB028011; XX DT 30-NOV-1999 (Rel. 61, Created) DT 21-JUN-2001 (Rel. 68, Last updated, Version 5) XX DE Schizosaccharomyces pombe gene for Hypothetical protein, partial cds, DE clone:TC78. XX KW . XX OS Schizosaccharomyces pombe (fission yeast) OC Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina; OC Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; OC Schizosaccharomyces. XX RN [1] RP 1-604 RA Ding D., Tomita Y., Hiraoka Y.; RT ; RL Submitted (24-MAY-1999) to the EMBL/GenBank/DDBJ databases. RL Da-Qiao Ding, Communications Research Laboratory, Kansai Advanced Research RL Center; 588-2, Iwaoka, Iwaoka-cho, Nishiku, Kobe, Hyogo 651-2401, Japan RL (E-mail:ding@crl.go.jp, Tel:+81-78-969-2240, Fax:+81-78-969-2249) XX RN [2] RX DOI; 10.1046/j.1365-2443.2000.00317.x RX PUBMED; 10759889. RA Ding D.Q., Tomita Y., Yamamoto A., Chikashige Y., Haraguchi T., Hiraoka Y.; RT "Large-scale screening of intracellular protein localization in living RT fission yeast cells by the use of a GFP-fusion genomic DNA library"; RL Genes Cells 5(3):169-190(2000). XX CC An S. pombe gene library in which genomic DNA fragments are fused CC to the 5'-end of the GFP-S65T gene was constructed. S. pombe CC strain was transformed with the library DNA amplified in E.coli. CC Plasmids of those transformants that showed interesting GFP CC localization were isolated, and their nucleotide sequences were CC determined. Detailed information and images can be seen in our web CC site (http://www-karc.crl.go.jp/bio/CellMagic/). Note: Only major CC localization is described for each clone in most cases. Because it CC is a random fusion of DNA fragment with the GFP gene, the CC subcellular localization of the fusion protein may differ from CC that of the full-length gene product. XX FH Key Location/Qualifiers FH FT source 1..604 FT /organism="Schizosaccharomyces pombe" FT /strain="968 h90" FT /mol_type="genomic DNA" FT /clone="TC78" FT /note="subcellular localization of GFP fusion; Membrane and FT cytoplasmic dots" FT /db_xref="taxon:4896" FT CDS <1..>604 FT /codon_start=1 FT /gene="SPBC1734.04" FT /product="Hypothetical protein" FT /db_xref="GENEDB:SPBC1734.04" FT /db_xref="GOA:O74745" FT /db_xref="InterPro:IPR005109" FT /db_xref="UniProtKB/Swiss-Prot:O74745" FT /protein_id="BAA87315.1" FT /translation="HSWVYWRDVDVETAPNTILEDLMRHDKDIIVPNVYRPLPDWLGNE FT QPYDLNSWAESETALQLADTLGEDDVIVEGYAEYATWRPHLAYLRDPNGDPSVEMPLDG FT IGGVSIMSKAKVHLEGCEFPAFSFEKHAETEGFGKMAKRMGFSVYGLPHYVIWHIYEPS FT DDDKRIMAEMERERKEREAAELEEAKKYQTAGFTQPDD" XX SQ Sequence 604 BP; 168 A; 111 C; 152 G; 173 T; 0 other; cattcttggg tttactggag agatgttgac gtggagactg ctccaaacac tattttggag 60 gatcttatgc gccatgataa agacattatt gttcctaacg tttatagacc cttaccagat 120 tggttgggca atgagcaacc atatgattta aattcatggg ctgaatctga gactgctctt 180 cagcttgcag atactttggg cgaagacgac gttattgtag aaggatacgc agagtatgct 240 acctggcgcc ctcatttggc ttaccttcgt gatcctaatg gtgacccatc tgttgaaatg 300 ccactggatg gtattggtgg tgtatctatt atgtctaaag ctaaagtaca cctagaaggt 360 tgcgagtttc ccgcattttc atttgaaaag catgctgaaa ccgaaggatt tggaaaaatg 420 gctaagcgga tggggttttc cgtttacgga cttcctcact atgttatttg gcatatttat 480 gaacctagcg atgatgataa gcgtattatg gctgaaatgg aacgcgaaag gaaagaaagg 540 gaggccgcag agcttgaaga ggctaaaaag tatcagactg ctggattcac gcaaccagat 600 gatc 604 // ![]() |