![]() |
EBI DbfetchID AB027831; SV 1; linear; genomic DNA; STD; FUN; 191 BP. XX AC AB027831; XX DT 30-NOV-1999 (Rel. 61, Created) DT 21-JUN-2001 (Rel. 68, Last updated, Version 4) XX DE Schizosaccharomyces pombe gene for Hypothetical protein, partial cds, DE clone:V125. XX KW . XX OS Schizosaccharomyces pombe (fission yeast) OC Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina; OC Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; OC Schizosaccharomyces. XX RN [1] RP 1-191 RA Ding D., Tomita Y., Hiraoka Y.; RT ; RL Submitted (24-MAY-1999) to the EMBL/GenBank/DDBJ databases. RL Da-Qiao Ding, Communications Research Laboratory, Kansai Advanced Research RL Center; 588-2, Iwaoka, Iwaoka-cho, Nishiku, Kobe, Hyogo 651-2401, Japan RL (E-mail:ding@crl.go.jp, Tel:+81-78-969-2240, Fax:+81-78-969-2249) XX RN [2] RX DOI; 10.1046/j.1365-2443.2000.00317.x RX PUBMED; 10759889. RA Ding D.Q., Tomita Y., Yamamoto A., Chikashige Y., Haraguchi T., Hiraoka Y.; RT "Large-scale screening of intracellular protein localization in living RT fission yeast cells by the use of a GFP-fusion genomic DNA library"; RL Genes Cells 5(3):169-190(2000). XX CC An S. pombe gene library in which genomic DNA fragments are fused CC to the 5'-end of the GFP-S65T gene was constructed. S. pombe CC strain was transformed with the library DNA amplified in E.coli. CC Plasmids of those transformants that showed interesting GFP CC localization were isolated, and their nucleotide sequences were CC determined. Detailed information and images can be seen in our web CC site (http://www-karc.crl.go.jp/bio/CellMagic/). Note: Only major CC localization is described for each clone in most cases. Because it CC is a random fusion of DNA fragment with the GFP gene, the CC subcellular localization of the fusion protein may differ from CC that of the full-length gene product. XX FH Key Location/Qualifiers FH FT source 1..191 FT /organism="Schizosaccharomyces pombe" FT /strain="968 h90" FT /mol_type="genomic DNA" FT /clone="V125" FT /note="subcellular localization of GFP fusion; Nucleus" FT /db_xref="taxon:4896" FT CDS <1..>191 FT /codon_start=1 FT /product="Hypothetical protein" FT /db_xref="GENEDB:SPAC25B8.16" FT /db_xref="GOA:Q9UTA4" FT /db_xref="InterPro:IPR009723" FT /db_xref="InterPro:IPR012590" FT /db_xref="UniProtKB/Swiss-Prot:Q9UTA4" FT /protein_id="BAA87135.1" FT /translation="FYEMKRSTGGTQPKGLNVKRSKLADARFIEVESPALSNGAVDLKK FT FIESRSFEITALQDAMKRS" XX SQ Sequence 191 BP; 69 A; 32 C; 41 G; 49 T; 0 other; ttttatgaaa tgaagcgttc aactggagga acgcaaccaa agggactaaa cgtcaaaagg 60 tcaaagctcg ctgatgctag attcatagag gttgaatcac ctgccctttc aaatggtgct 120 gtagacttaa aaaaattcat tgaatcaagg agttttgaaa taacggcttt acaagatgct 180 atgaaaagat c 191 // ![]() |