![]() |
EBI DbfetchID AB005263; SV 1; linear; mRNA; STD; PRO; 143 BP. XX AC AB005263; XX DT 07-APR-1998 (Rel. 55, Created) DT 29-DEC-2008 (Rel. 98, Last updated, Version 3) XX DE Buchnera aphidicola argA mRNA for N-acetylglutamate synthase, partial cds. XX KW . XX OS Buchnera aphidicola OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Buchnera. XX RN [1] RP 1-143 RA Nakabachi A.; RT ; RL Submitted (26-JUN-1997) to the EMBL/GenBank/DDBJ databases. RL Contact:Atsushi Nakabachi University of Tokyo, Department of Biological RL Sciences, Graduate School of Science; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113, RL Japan XX RN [2] RX DOI; 10.1016/S0965-1748(97)00092-1 RX PUBMED; 9569646. RA Nakabachi A., Ishikawa H.; RT "Differential display of mRNAs related to amino acid metabolism in the RT endosymbiotic system of aphids"; RL Insect Biochem. Mol. Biol. 27(12):1057-1062(1997). XX FH Key Location/Qualifiers FH FT source 1..143 FT /organism="Buchnera aphidicola" FT /host="Acyrthosiphon sp." FT /mol_type="mRNA" FT /db_xref="taxon:9" FT CDS <1..>143 FT /codon_start=2 FT /transl_table=11 FT /gene="argA" FT /product="N-acetylglutamate synthase" FT /db_xref="GOA:O66143" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR001048" FT /db_xref="InterPro:IPR010167" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/Swiss-Prot:O66143" FT /protein_id="BAA25386.1" FT /translation="KTFVIMLGGEAIKYGNFYSIINDIGLLHSLGIRLVVVYGACPQIN FT TS" XX SQ Sequence 143 BP; 45 A; 14 C; 29 G; 55 T; 0 other; taaaacgttt gtaataatgt taggtggtga agcgatcaaa tatggaaatt tttatagtat 60 cattaatgat ataggattat tacatagttt aggcattcgt ttggtagttg tatacggcgc 120 ttgtcctcaa attaatacta gtt 143 // ![]() |