![]() |
EBI DbfetchID AB003087; SV 1; linear; genomic DNA; STD; PRO; 492 BP. XX AC AB003087; XX DT 06-MAY-1997 (Rel. 51, Created) DT 14-APR-2005 (Rel. 83, Last updated, Version 3) XX DE Bacillus stearothermophilus DNA for Pyrophosphatase, partial cds. XX KW Pyrophosphatase. XX OS Geobacillus stearothermophilus OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Geobacillus. XX RN [1] RP 1-492 RA Samejima T.; RT ; RL Submitted (11-APR-1997) to the EMBL/GenBank/DDBJ databases. RL Tatsuya Samejima, Aoyama Gakuin University, Department of Chemistry, RL College of Science and Engineering; Chitosedai 6-16-1, Setagaya-ku, Tokyo RL 157, Japan (E-mail:samejima@fatima.chem.aoyama.ac.jp, Tel:03-5384-1111, RL Fax:03-5384-6200) XX RN [2] RA Satoh T., Ishii K., Koyama M., Sakurai N., Kaji H., Hachimori A., Irie M., RA Samejima T.; RT "Primary structure,overexpression,characterization and crystallization o f RT inorganic pyrophosphatase from Bacillus stearothermophilus."; RL Unpublished. XX DR StrainInfo; 46428; ATCC 12016. XX FH Key Location/Qualifiers FH FT source 1..492 FT /organism="Geobacillus stearothermophilus" FT /strain="ATCC 12016" FT /mol_type="genomic DNA" FT /db_xref="taxon:1422" FT CDS <1..>492 FT /codon_start=1 FT /transl_table=11 FT /gene="pMK2PPA" FT /product="Pyrophosphatase" FT /note="Bst.PPase" FT /note="Region amplified by PCR is base 21-472 FT (corresponding to amino acid Val 7 to Ala 158" FT /note="The expression vector contains start codon ATG and FT stop codon TGA and TAA" FT /db_xref="GOA:O05724" FT /db_xref="InterPro:IPR008162" FT /db_xref="UniProtKB/Swiss-Prot:O05724" FT /protein_id="BAA19837.1" FT /translation="AFENKIVEAFIEIPTGSQNKYEFDKERGIFKLDRVLYSPMFYPAE FT YGYLQNTLALDGDPLDILVITTNPTFPGCVIDTRVIGYLNMVDSGEEDAKLIGVPVEDP FT RFDEVRSIEDLPQHKLKEIAHFFERYKDLQGKRTEIGTWEGPEAAAKLIDECIARYNEQ FT K" XX SQ Sequence 492 BP; 143 A; 118 C; 125 G; 106 T; 0 other; gcctttgaga ataagattgt cgaagcgttt atcgaaattc caactgggag ccaaaacaaa 60 tacgaattcg acaaagaacg gggcattttc aagctcgacc gcgtcttata ttcaccgatg 120 ttttatccgg ctgaatacgg ctatttgcaa aatacgttgg cgctggatgg cgacccgctc 180 gacattttgg tcatcacgac aaacccgacg ttcccgggct gtgtcattga tacgcgtgtc 240 atcggctatt tgaacatggt cgacagcggc gaagaagatg cgaaattgat cggcgttccg 300 gtcgaagatc cgcgctttga cgaagttaga tcgattgaag atctcccgca gcacaaactg 360 aaagaaatcg cccacttctt tgaacgctac aaagacttgc aagggaaacg gacggaaatc 420 ggcacatggg aggggccgga agcagccgcc aaattgatcg acgaatgcat cgcccgctat 480 aacgaacaaa aa 492 // ![]() |