![]() |
EBI DbfetchID CAM09274; SV 1; linear; genomic DNA; STD; PRO; 489 BP. XX PA AL157959.1 XX DE Neisseria meningitidis Z2491 dihydrofolate reductase XX OS Neisseria meningitidis Z2491 OC Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae; OC Neisseria. OX NCBI_TaxID=122587; XX FH Key Location/Qualifiers FH FT source 1..489 FT /organism="Neisseria meningitidis Z2491" FT /strain="Z2491" FT /mol_type="genomic DNA" FT CDS complement(AL157959.1:2126278..2126766) FT /transl_table=11 FT /locus_tag="NMA2179" FT /product="dihydrofolate reductase" FT /EC_number="1.5.1.3" FT /note="NMA2179, folA, dihydrofolate reductase, len: 162aa; FT similar to many eg. SW:P12833 (DYR3_SALTY) FT dhfrIII,dihydrofolate reductase type III from Salmonella FT typhimurium (162 aa) fasta scores; E(): 2.1e-26, 50.7% FT identity in 152 aa overlap. Contains Pfam match to entry FT PF00186 DiHfolate_red, Dihydrofolate reductase and Prosite FT match to PS00075 Dihydrofolate reductase signature." FT /db_xref="GOA:Q9JSQ9" FT /db_xref="HSSP:1DF7" FT /db_xref="InterPro:IPR017925" FT /db_xref="UniProtKB/Swiss-Prot:Q9JSQ9" FT /func_characterised="identical sequence" FT /protein_id="CAM09274.1" FT /translation="MLKITLIAACAENLCIGAGNAMPWHIPEDFAFFKAYTLGKPVIMG FT RKTWESLPVKPLPGRRNIVISRQADYCAAGAETAASLEAALALCAGAEEAVIMGGAQIY FT GQAMPLATDLRITEVDLSVEGDAFFPAIDRTHWKEAERTERRVSSKGTSYAFVHYLRY" XX SQ Sequence 489 BP; 120 A; 117 C; 152 G; 100 T; 0 other; 1202903116 CRC32; atgctcaaaa taaccctaat tgcggcgtgt gcggaaaacc tgtgcatcgg ggcgggcaat 60 gctatgcctt ggcacatccc cgaagatttc gcatttttca aagcctatac cttgggcaaa 120 cccgtcatta tggggcggaa aacgtgggaa tccctgcccg tcaaacccct gcctggacgg 180 aggaacatcg tcatcagccg gcaggcggat tattgcgcgg caggcgcgga aacggcggca 240 agtttggagg cggcattggc attgtgcgca ggcgcggaag aagccgtcat tatgggcggc 300 gcgcagatat acggacaagc gatgccattg gcgaccgatt tgcggataac cgaagtggat 360 ttgtctgtgg aaggagatgc atttttcccc gcaatagacc ggacgcattg gaaagaagca 420 gagcggacgg aacgccgtgt cagcagcaaa ggcacgagct atgcttttgt gcattatttg 480 agatattga 489 // ![]() |