![]() |
EBI DbfetchID CAL94263; SV 1; linear; genomic DNA; STD; PRO; 378 BP. XX PA AM406670.1 XX DE Azoarcus sp. BH72 holo-[acyl-carrier-protein] synthase XX OS Azoarcus sp. BH72 OC Bacteria; Proteobacteria; Betaproteobacteria; Rhodocyclales; OC Rhodocyclaceae; Azoarcus. OX NCBI_TaxID=62928; XX FH Key Location/Qualifiers FH FT source 1..378 FT /organism="Azoarcus sp. BH72" FT /strain="BH72" FT /mol_type="genomic DNA" FT CDS AM406670.1:1805634..1806011 FT /transl_table=11 FT /gene="acpS" FT /locus_tag="azo1646" FT /product="holo-[acyl-carrier-protein] synthase" FT /EC_number="2.7.8.7" FT /note="Holo-[acyl-carrier-protein] synthase, 50% Identity FT to TrEMBL;Q7NWB8, Q820I1. SProt;Q9KPB6(49%). Has FT PF01648,4'-phosphopantetheinyl transferase superfamily; FT IPR008278 4-PPT_transf; Members of this family transfers FT the 4'-phosphopantetheine (4'-PP) moiety from coenzyme A FT (CoA) to the invariant serine of PP-binding. This FT post-translational modification renders holo-ACP capable of FT acyl group activation via thioesterification of the FT cysteamine thiol of 4'-PP. This superfamily consists of two FT subtypes: The ACPS type such as P24224 and the Sfp type FT such as P39135. The structure of the Sfp type is known FT which shows the active site accommodates a magnesium ion. FT The most highly conserved regions of the alignment are FT involved in binding the magnesium ion." FT /db_xref="GOA:A1K608" FT /db_xref="InterPro:IPR004568" FT /db_xref="UniProtKB/Swiss-Prot:A1K608" FT /func_characterised="identical sequence" FT /protein_id="CAL94263.1" FT /translation="MIHGIGTDIVHIARIRTSLERHGERFAERILAESEREAWRASRDP FT ARFLAKRFAAKEAFGKALGTGVAVPATLHAVAVDHDALGKPLYRYGDGLQTYLDDRRLN FT AHLSLTDENDYVVAFAVIETR" XX SQ Sequence 378 BP; 69 A; 132 C; 119 G; 58 T; 0 other; 3801213725 CRC32; atgatccacg gcatcggaac cgacatcgtc cacatcgccc gcatccggac ctcgctggag 60 cgtcacggcg agcgcttcgc ggagcgcatc ctggccgaat ccgagcgcga ggcatggcgc 120 gcgagccgcg atcccgcgcg cttcctcgca aagcgtttcg ctgccaagga agcgttcggc 180 aaggcgctcg gcaccggcgt tgcggtgcct gccacgctgc acgcagtggc cgtggatcac 240 gatgcgctcg gcaagccgct ctatcgatat ggcgacggcc tgcagaccta tctggacgac 300 cggcgcctga acgcccacct gagcctgacc gacgaaaacg actatgtggt cgccttcgcg 360 gtaatcgaga cccgatga 378 // ![]() |