![]() |
EBI DbfetchID CAL92935; SV 1; linear; genomic DNA; STD; PRO; 471 BP. XX PA AM406670.1 XX DE Azoarcus sp. BH72 riboflavin synthase XX OS Azoarcus sp. BH72 OC Bacteria; Proteobacteria; Betaproteobacteria; Rhodocyclales; OC Rhodocyclaceae; Azoarcus. OX NCBI_TaxID=62928; XX FH Key Location/Qualifiers FH FT source 1..471 FT /organism="Azoarcus sp. BH72" FT /strain="BH72" FT /mol_type="genomic DNA" FT CDS complement(AM406670.1:343013..343483) FT /transl_table=11 FT /gene="ribH" FT /locus_tag="azo0318" FT /product="riboflavin synthase" FT /function="Riboflavin synthase beta-chain" FT /EC_number="2.5.1.9" FT /note="67-dimethyl-8-ribityllumazine synthase (EC 2.5.1.9) FT (DMRL synthase) (Lumazine synthase) (Riboflavin synthase FT beta chain). Riboflavin synthase is a bifunctional enzyme FT complex catalyzing the formation of riboflavin from FT 5-amino-6-(1-D)- ribityl-amino-24(1H3H)-pyrimidinedione and FT L-34-dihydrohy-2- butanone-4-phosphate via FT 67-dimethyl-8-lumazine. The beta subunit catalyzes the FT condensation of 5-amino-6-(1-D)-ribityl-amino- FT 24(1H3H)-pyrimidinedione with L-34-dihydrohy-2-butanone-4- FT phosphate yielding 67-dimethyl-8-lumazine (By similarity). FT ribH: riboflavin synthase beta subunit" FT /note="High confidence in function and specificity" FT /db_xref="GOA:A1K280" FT /db_xref="InterPro:IPR002180" FT /db_xref="UniProtKB/Swiss-Prot:A1K280" FT /func_characterised="identical sequence" FT /protein_id="CAL92935.1" FT /translation="MARYDNIAEFESDLNGKGLRVGIVMSRFNQDVCEGLLSACTEELQ FT KLGVSPELIRIATVPGALEIPLVLQKMGQSGKFDALIALGAVIRGETYHFELVSNEMGA FT GITRIGLDTGIPIANGVLTTEDDDQALARMQEKGSDCARAAVEMANLLKVLQ" XX SQ Sequence 471 BP; 97 A; 156 C; 148 G; 70 T; 0 other; 2913428922 CRC32; atggcccgtt acgacaacat cgctgaattc gaatccgacc tcaacggcaa aggcctgcgc 60 gtcggcatcg tcatgagccg cttcaatcag gacgtctgcg aagggctgct gtccgcctgt 120 accgaagagc tgcagaagct cggcgtgtcg cccgaactga tccgcatcgc caccgtgccc 180 ggcgcgctgg aaatcccgct ggtgctgcag aagatggggc agagcggcaa gttcgacgcg 240 ctgatcgcgc tcggcgcggt gatccgcggc gagacctacc acttcgaact cgtctccaac 300 gaaatgggcg ccggcatcac ccgcatcggc ctggacaccg gcattccgat cgccaacggc 360 gtgctgacca ccgaagacga cgaccaggcg ctggcccgca tgcaggaaaa aggcagcgac 420 tgcgcgcgcg ccgcggtgga gatggccaac ctgctgaagg tcctgcaatg a 471 // ![]() |